(data stored in ACNUC7421 zone)

EMBL: CP001111.PE517

CP001111.PE517       Location/Qualifiers
FT   CDS_pept        609042..609773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0517"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: xom:XOO_0726 IpsJ protein; TIGRFAM: 3-oxoacid
FT                   CoA-transferase, A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50222"
FT                   /db_xref="GOA:B4SJ54"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ54"
FT                   /protein_id="ACF50222.1"
FT                   /translation="MQQSTSTGKRGKRFASAAEALQGVVADGQTLAVGGFGLCGIPEAL
FT                   IAALRDSGAKGLTVISNNAGVDGFGLGQLLETRQIKKMISSYVGENKEFERQFLAGELE
FT                   LEFNPQGTLAERLRAGGAGIPAFFTATGYGTVVAEGKETREFDGKHYVMETALRADVAL
FT                   VKAWKADEAGNLVFRKTARNFNPACAMAGKVCIVEVEEVVPVGAIDPDQVHLPGIYVHR
FT                   IVHNPHPEKRIEQRTIRAEGN"
     atgcagcaat cgacttccac cggcaagcgc ggcaagcgct tcgccagtgc ggcggaggcc        60
     ctgcaagggg tggtcgccga tggccagacg ctggccgtgg gcggcttcgg cctgtgtggc       120
     attcccgagg ccctgatcgc cgcgctgcgc gacagtggcg ccaagggcct gaccgtgatc       180
     tccaacaatg ccggcgtcga tggtttcggc ctgggccagc tgctggaaac ccggcagatc       240
     aagaagatga tttcgtccta cgtgggcgag aacaaggaat tcgagcgcca gttcctggcc       300
     ggcgagctgg agctggaatt caatccgcag ggcaccctgg ccgagcgcct gcgtgccggc       360
     ggtgcgggca tcccggcgtt cttcactgcc actggctacg gcacggtggt ggccgagggc       420
     aaggaaaccc gcgagttcga cggcaagcac tacgtgatgg agaccgcgct gcgtgccgat       480
     gtcgcgctgg tcaaggcgtg gaaggccgac gaagcgggca acctggtgtt ccgcaagacc       540
     gcgcgcaact tcaacccggc ctgcgcgatg gccggcaagg tctgcatcgt ggaagtggag       600
     gaggtggtgc cggtgggcgc catcgatccg gaccaggtgc acctgccggg tatctacgtg       660
     catcgcatcg tgcacaaccc gcatcctgaa aagcgtatcg aacagcgcac catccgcgcg       720
     gagggcaact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page