(data stored in ACNUC7421 zone)

EMBL: CP001111.PE519

CP001111.PE519       Location/Qualifiers
FT   CDS_pept        complement(610418..612478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50224"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR032719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ56"
FT                   /protein_id="ACF50224.1"
FT                   /translation="MSGAASGIRQLSFSVLRALFRALPMPAALRDRLRNQGLDRIGSWS
FT                   PPPPRGRVGAAADGARALLRADERAIGYAAAEDAPLPAAPPATLVAFYLPQFHPFEEND
FT                   AWWGKGFTEWRNVSRALPQFEGHVQPRLPGDLGFYDLRVGETLRAQAKLATDHGIGAFC
FT                   FYFYWFSGHTLMEQPLRQWLADSTIELPFCLCWANENWTRRWDGRNQDVLIGQQHSEQD
FT                   DLAFIAHIAEYLRDRRALKVDGHPVLLLYRPQLLPDPKATAARWRGWCRDNGIGEIHLA
FT                   YVQSFERPDPRDIGFDAAVEFPPNIAAPRQLNTSQFLLNPGYEGDVRDWRELAAQMRTA
FT                   PLPDYPLYPGVNPGWDNEARRPGRGRVLLHASPRGYADWLHDTVHGRLRDVPPARRMVF
FT                   INAWNEWAESAVLEPDARLGHAWLQATRRAMTPSQPAPSRPCVVIHAWHLDALPELLSA
FT                   VKDSGLPARLVITTTSDRQAQVQSITESHGLPAEIWAYDNHGRDILPFLHAADRLLQQN
FT                   ESLVLKLHTKRSTHRDNGDQWRREMVDALLGPAQAAANLAHLQADPRLGLMAPAGHLLN
FT                   VADYIGGNAQRMERLWAQLGLDGAPGDGQFASGSMFWVRLQALRPLLDAHLLPSMFEVE
FT                   AGQIDGTLAHAIERATGAVATCAGFSVGDTSQVHGAPPQPASAGYPYARGG"
     atgagtggcg cagcgtccgg catccgccag ctcagcttct ccgtcctgcg cgcgttgttc        60
     cgtgccctgc cgatgcccgc ggcgctgcgc gatcgcctgc gcaaccaagg cctggaccgc       120
     atcggcagct ggagcccacc gccgccgcgc ggtcgtgtcg gcgcagcagc cgatggtgcg       180
     cgtgcgctgc tgcgtgccga tgaacgggcg atcggttacg ccgccgcgga agacgcacca       240
     ttgccggcag caccgccagc cacgctggtg gccttctatc tgccgcagtt ccatccattc       300
     gaagagaacg atgcgtggtg gggcaagggc ttcaccgagt ggcgcaatgt cagccgcgcc       360
     ttaccccagt tcgagggtca tgtacaaccg cgcctgcccg gcgacctggg cttctacgac       420
     cttcgcgttg gcgagacgct acgtgcgcag gcgaaactgg ccacagacca cggcatcggt       480
     gccttctgct tctacttcta ctggttcagt ggccacacgc tgatggagca gcccctgcgt       540
     caatggctgg ccgacagcac gattgaactg cctttctgcc tgtgctgggc caacgagaac       600
     tggacccggc gctgggatgg tcgaaaccag gacgtgctga tcggccagca gcacagcgag       660
     caggatgatc tggccttcat cgcccacatc gccgaatacc tgcgggaccg ccgggcattg       720
     aaggtcgatg gacaccccgt gctgctgctg tatcgcccgc aactgctgcc cgatcccaag       780
     gccacggccg cgcgctggcg cggctggtgc cgtgacaatg gcatcggcga gatccatctg       840
     gcctatgtcc agagtttcga gcgcccggac ccacgcgata tcggcttcga tgccgccgtg       900
     gagttcccgc cgaacatagc cgctccacgt cagctgaaca cgtcccagtt cctgctcaac       960
     cccggctacg aaggcgacgt gcgcgactgg cgcgagctgg cggcgcagat gcgcacggca      1020
     ccgttaccgg actatccgtt gtatccgggc gtaaatccgg gttgggacaa cgaggcccgc      1080
     cgccccggac gcggacgcgt cctgctgcac gcgtcgccgc gcggctatgc tgactggctg      1140
     cacgacacgg tgcacggacg cctgcgcgat gttccgccgg ccaggcgcat ggtgttcatc      1200
     aacgcctgga acgaatgggc ggaaagtgct gtgctcgagc ccgacgcccg cctcggccat      1260
     gcctggctgc aggccacccg ccgcgcaatg acgccctcgc agcctgcacc atcgcggccg      1320
     tgcgtcgtca tccatgcctg gcacttggac gcgctgcccg agctgttgag cgcggtgaag      1380
     gacagcgggc ttccggcacg tcttgtcatc accaccacat ctgaccggca agcacaggtg      1440
     cagtcgatca ccgagtcgca cggactgcct gccgagatct gggcctacga caaccacggc      1500
     cgcgacatcc tgcccttcct gcatgccgcc gaccggctgc tgcagcagaa cgaatcgctg      1560
     gtgctgaagc tgcataccaa gcgctccacc catcgcgaca acggtgacca gtggcggcgc      1620
     gagatggttg atgcgctgct gggcccggcc caggcggcgg cgaacctggc ccatctccaa      1680
     gccgatcccc gcctggggct gatggctcct gccgggcatc tgctgaatgt ggccgactac      1740
     atcggtggca atgcacagcg catggagcgg ctgtgggcac agctggggct ggacggtgcg      1800
     cccggcgacg gtcagttcgc gtccggcagc atgttctggg tgcgcctgca ggcactgcgc      1860
     ccgctgctgg atgcgcacct gctgcccagc atgttcgagg tcgaagccgg ccagatcgat      1920
     ggcaccctgg cccatgccat cgagcgcgcg accggtgccg tggccacgtg cgccggcttc      1980
     tccgtgggcg acacctccca ggtgcacggc gcccccccac aaccagcatc cgcgggctac      2040
     ccatatgccc gcgggggctg a                                                2061
//

If you have problems or comments...

PBIL Back to PBIL home page