(data stored in ACNUC7421 zone)

EMBL: CP001111.PE526

CP001111.PE526       Location/Qualifiers
FT   CDS_pept        complement(618255..618638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0526"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: xcb:XC_3597 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50231"
FT                   /db_xref="GOA:B4SJ63"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ63"
FT                   /protein_id="ACF50231.1"
FT                   /translation="MSIDLTGLSARELGALIRTAKKQQTIVAKRRPITKVRAQLIKLAK
FT                   TEGYTIEELFGDAPAPRARKVAKAAKAPSKTAGRKLGKVAPKYRNPANPKETWTGRGKQ
FT                   PRWMAELTAKGNKKPEDFLIKKA"
     atgagcattg acctgaccgg cctgtcggca cgcgagctgg gcgccctgat ccgcaccgcc        60
     aagaagcagc agaccatcgt cgccaagcgc cggccgatca ccaaggtccg ggcccagctg       120
     atcaagctgg ccaagaccga gggttacacc atcgaggaac tgttcggcga tgccccggcc       180
     ccgcgcgcgc gcaaagtggc caaggccgcc aaggcaccgt cgaagaccgc cggccgcaag       240
     ctgggcaagg ttgccccgaa gtaccgcaac ccggccaatc cgaaggaaac ctggaccggt       300
     cgcggcaagc agccgcgctg gatggccgaa ctgaccgcca agggcaacaa gaagccggaa       360
     gatttcctga tcaagaaggc ctga                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page