(data stored in ACNUC7421 zone)

EMBL: CP001111.PE527

CP001111.PE527       Location/Qualifiers
FT   CDS_pept        complement(618861..620564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0527"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: xac:XAC3567 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Anticodon-binding domain protein;
FT                   YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50232"
FT                   /db_xref="GOA:B4SJ64"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ64"
FT                   /protein_id="ACF50232.1"
FT                   /translation="MRLSQFHLHTTKETPSDAELTSHRLMLRAGMIRKLASGLYTWSPL
FT                   GLRVLRKVERIVREEMDRAGAVEFQIPTIQPKELWEQTGRWQKFGPQLLKIKDRKDQTF
FT                   CYSPTAEEAACDFARSELSSYKQLPVNFYQIQTKFRDEIRPRFGVMRSREFLMKDAYSF
FT                   HLHDECLVREYENMKSAYSRIFTRLGLDFRMVQADSGAIGGDASQEFHVIADSGEDALV
FT                   FSTGSDYAANMEAAIAADPAPRAAASEAMRKVDTPTQKTCEDVAALLGINLQRTVKSVA
FT                   LIAGEGEAQQFVLVLVRGDHEVNEIKLAKVAGLDEQRFASEAEIAEHLGSVPGFLGPIA
FT                   PAKAIRVVADREVAAMSDFVVGANEAGFHLAGVNWGRDLAEPEVADIRNVRAGDRALDG
FT                   GELKIARGIEVGHVFQLGRTYARALDATVLDENGKAAVMAMGCYGIGISRVVAAAIEQN
FT                   HDDAGIIWPDAMAPWQVVVCVINPKGDAAVADAATNLLQELRDAGLDAALDDRGLRPGA
FT                   MFADMELIGIPHRVVVSERGLAAGTYEYRSRRASEAESLDKATLLQRLQG"
     atgcgcctct cccagttcca cctgcacacc accaaggaaa cccccagcga cgccgagctc        60
     accagccacc ggctgatgct gcgcgcgggc atgatccgca agctcgcatc cggcctgtac       120
     acctggtcgc cgctgggcct gcgcgtgctg cgcaaggttg aacgcatcgt ccgcgaggaa       180
     atggaccgtg ccggtgccgt ggaattccag atcccgacca tccagccgaa ggaactgtgg       240
     gagcagaccg gccgctggca gaagttcggc ccgcagctgc tgaagatcaa ggaccgcaag       300
     gaccagacct tctgctacag cccgaccgcc gaggaagccg cctgcgactt cgcgcgcagc       360
     gagctgtcca gctacaagca gctgccggtc aacttctacc agatccagac caaattccgc       420
     gacgagatcc gcccgcgctt cggcgtgatg cgttcacgcg aattcctgat gaaggacgcc       480
     tactcgttcc acctgcacga tgagtgcctc gtgcgcgagt acgagaacat gaagtcggcc       540
     tacagccgca tcttcacccg cctcggcctg gatttccgca tggtgcaggc ggactccggt       600
     gcgatcggtg gcgacgcctc gcaggaattc cacgtgatcg ccgattccgg cgaagatgcg       660
     ctggtgttct ccaccggctc ggactacgcg gccaacatgg aagcggcgat tgccgccgat       720
     ccggcaccgc gtgcggccgc cagcgaagcc atgcgcaagg tcgatacccc cacccagaag       780
     acctgcgagg atgtcgcggc cctgctcggc atcaacctgc agcgcacggt gaagtcggtg       840
     gcgctgatcg ccggcgaagg cgaagcacag cagttcgtgc tggtgctggt gcgcggtgac       900
     cacgaggtca acgagatcaa gctggccaag gttgccggcc tggatgaaca gcgcttcgcc       960
     agtgaggcgg aaatcgccga gcacctgggc agcgtgccgg gcttcctcgg cccgattgcg      1020
     ccggccaagg ccatccgcgt ggtggctgat cgcgaagtgg cggcgatgtc cgacttcgtc      1080
     gtcggcgcca acgaagccgg tttccacctg gccggcgtca actggggccg cgatctggcg      1140
     gaaccggaag tggccgacat ccgcaacgtg cgtgccggtg accgcgcgct ggacggtggt      1200
     gaactgaaga tcgcccgtgg catcgaagtc ggtcacgtgt tccagctcgg ccgtacgtac      1260
     gcccgagcgc ttgatgccac cgtgctggac gagaatggca aggccgcggt gatggcgatg      1320
     ggctgctatg gcatcggcat ctcgcgcgtg gtggctgccg cgatcgaaca gaaccatgac      1380
     gatgccggca tcatctggcc ggacgcgatg gcgccgtggc aggtggtggt gtgcgtgatc      1440
     aacccgaagg gggacgccgc cgtggccgac gccgccacca acctgctgca ggaactgcgc      1500
     gatgcgggcc tggacgcggc gctcgatgac cgtggcctgc gcccgggcgc gatgttcgcc      1560
     gacatggaac tgatcggcat cccgcaccgc gtggtggtga gcgaacgtgg cctggccgcc      1620
     ggtacctacg agtaccgctc gcgccgcgcc agcgaagcgg aaagcctgga caaggccacc      1680
     ctgctgcagc gcctgcaggg ttga                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page