(data stored in ACNUC7421 zone)

EMBL: CP001111.PE528

CP001111.PE528       Location/Qualifiers
FT   CDS_pept        complement(621158..621532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfn:XfasM23_1728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50233"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ65"
FT                   /protein_id="ACF50233.1"
FT                   /translation="MRALSCLGCLLLLASANAVAGPVYKWKDANGVTQYSETPPAGKKF
FT                   ETREQARSPQAAASAETPAAPVPEQCSTARANLALLDSTGTVMQDTNGDGKADTALTQE
FT                   QRSAQKGLAEAAIKAYCPAE"
     atgcgtgccc tgtcctgcct tggatgcctg ctgctgttgg ccagtgccaa cgccgtggcc        60
     ggcccggtct ataaatggaa ggacgccaat ggcgtgaccc agtattcgga gaccccgccg       120
     gcgggcaaga agttcgagac ccgcgagcag gcccgcagcc cgcaggcagc ggccagcgcc       180
     gagacccccg ccgcgccggt gcccgagcag tgcagcaccg cccgcgccaa cctggccctg       240
     ctggacagca ccggcaccgt catgcaggac accaacggcg acggcaaggc cgataccgcg       300
     ttgacccagg agcagcgcag cgcgcagaag ggattggctg aagccgccat caaggcctac       360
     tgcccggcgg agtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page