(data stored in ACNUC7421 zone)

EMBL: CP001111.PE531

CP001111.PE531       Location/Qualifiers
FT   CDS_pept        622886..623383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0531"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: xcv:XCV3688 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50236"
FT                   /db_xref="GOA:B4SJ68"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ68"
FT                   /protein_id="ACF50236.1"
FT                   /translation="MSAVRQPGPVSLRALRESDLTVVMAIEVRGYPFPWTRGIFVDCLR
FT                   AGYPGLAMERDGELIGYGMLSIAADEAHVLNICIDPLTQSRGLGRQLLRALVQLAGDRG
FT                   AQRVFLEVRPSNTPALALYHSEGFNEIGRRPRYYPAAQGREDAVVMAIELVHGDLQAMP
FT                   PL"
     gtgagtgcgg tccggcagcc cggtccggtc agcctgcgcg cgctgcgcga gagcgacctc        60
     acggtggtga tggcgatcga ggtgcgcggt tatccgtttc cgtggacccg cggcatcttc       120
     gtggattgcc tgcgtgccgg ttaccccggc ctggccatgg agcgtgacgg cgagctgatc       180
     ggctacggca tgctcagcat cgccgccgac gaggcacatg tcctcaacat ctgcatcgat       240
     ccgttgacgc agtcgcgtgg cctgggtcgc cagttgctgc gcgcactggt gcaactggcc       300
     ggcgaccgtg gcgcgcagcg tgtgttcctg gaagtgcggc cttcgaatac accggcactg       360
     gcgctgtatc acagcgaagg cttcaacgag atcggccgtc gcccgcgcta ctacccggcg       420
     gcacagggcc gcgaggacgc ggtggtgatg gcgatcgaac tggtccacgg cgacctgcag       480
     gcgatgccgc cgctgtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page