(data stored in ACNUC7421 zone)

EMBL: CP001111.PE532

CP001111.PE532       Location/Qualifiers
FT   CDS_pept        complement(623451..624272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0532"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cti:RALTA_B0369 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50237"
FT                   /db_xref="GOA:B4SJ69"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ69"
FT                   /protein_id="ACF50237.1"
FT                   /translation="MPLSIFLLVLAAAALHASWNAIVKRGPDKFLGTVLVTGSAALLSA
FT                   AALPFLPFPAAHSWPWLAASVLLQVTYYGLVARCYQQVDMSLAYPLMRGSAPILVALAG
FT                   TLLGEQLSPAAWLGVVLVSTGILCMALGARGGQLRLPLLTAAMIATYTLVDAQGARQSG
FT                   SALSYTLWLFLLSGIPLPLWALYTRGGAVLDYARQHWPLGLAGGAGTTASYAMALWAMT
FT                   QAPVAMVSALRESSILFALLISVFLLRERIPRARWLAAALIVGGVLALRLA"
     atgccgcttt ccatcttcct gctggttctc gccgctgcag ccctgcacgc cagctggaac        60
     gcgatcgtca agcgcgggcc ggacaagttc ctcggcaccg tgctggtcac cggcagcgcc       120
     gcgttgctgt ccgccgctgc cctgcccttc ctgcccttcc ccgccgcgca cagctggcca       180
     tggctggccg cttcggtgct gctgcaggtg acctattacg ggctggtcgc acgttgttac       240
     cagcaggtcg acatgagcct ggcctacccg ctgatgcgtg gcagcgcgcc gatcctggtc       300
     gcgttggcgg gcacactgct gggcgagcag ctgtcgcctg cagcgtggct gggcgtggtg       360
     ctggtcagca ccggtatcct gtgcatggca ctgggtgcgc gtggcggcca gctgcgcctg       420
     ccgctgctga ccgcggcgat gatcgccacc tacaccctgg tcgatgcgca gggcgcgcgc       480
     cagtccggca gcgcactcag ctacacgctg tggctgttcc tgctgtcagg cattccgcta       540
     ccactgtggg cgttgtacac ccgcggcggc gcggtgctgg actatgcgcg gcagcattgg       600
     ccgctggggc tggccggcgg cgccggcacc accgcctctt acgcgatggc gctatgggca       660
     atgactcagg caccggtggc gatggtctcc gcgttgcgcg aatcgtcgat cctgttcgcg       720
     ttgctgatct cggtgttcct gctgcgcgaa cggattccgc gcgcgcgctg gctggcggcg       780
     gcgctgatcg tgggcggcgt gttggcgttg cggttggcgt ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page