(data stored in ACNUC7421 zone)

EMBL: CP001111.PE536

CP001111.PE536       Location/Qualifiers
FT   CDS_pept        complement(627947..629425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0536"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: xcv:XCV3681 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50241"
FT                   /db_xref="GOA:B4SJ73"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJ73"
FT                   /protein_id="ACF50241.1"
FT                   /translation="MALEFTLNHLAAASAAVDCLVVGAYADHTLTAAAQALDAASGGRL
FT                   AALAQRGDLSGKTGATTLLHDLPGVTAPRVLVVGLGEAARFGVPQYLKAVGDAVRALKA
FT                   GAVRSALFTLSEVAVKDRDAAWAIRQAVIAADHAAYRYTATLGKKKADDAGLAQLAIAG
FT                   DDAQALAQGQAIAAGVEFARELGNLPPNYCTPAYLAEVGVKFAGEHDGAEAEILDEHQM
FT                   EALGMGSLLAVARGSANRPRLVVLKWNNGGDAKPYVLVGKGITFDTGGVNLKTQGGIEE
FT                   MKYDMCGGANVIGTFVAAVKAKLPLNLVVVVPAVENAIDGNAYRPSDVITSMSGKTIEV
FT                   GNTDAEGRLILCDALTYAQRFEPAALVDVATLTGACMVALGHQTAGLMSKHDDLANELL
FT                   AAGEQVFDRAWRLPLWDEYQPMLDSTFADVYNIGGRWAGAITAGCFLSRFAEGQRWAHL
FT                   DIAGVASDEGKRGMATGRPVGLLSQWLLDQAARA"
     atggctctcg aattcaccct gaaccacctc gccgcggctt cggccgccgt tgattgcctg        60
     gtcgtcggcg cctatgccga ccataccctg actgcggccg cgcaggcact ggatgccgcc       120
     agcggtggcc gcctggccgc cctggcccag cgtggcgacc tgtccggcaa gaccggcgcg       180
     accaccctgc tgcacgacct gccgggcgtg accgccccgc gcgtactggt ggtcggcctg       240
     ggcgaagcgg cccgtttcgg cgtgccgcag tacctgaagg cggtcggcga tgccgtacgc       300
     gcgctgaagg ccggcgctgt ccgcagcgca ctgttcaccc tgtccgaagt ggcagtgaag       360
     gaccgcgatg cggcctgggc gatccgccag gcggtgatcg ccgccgatca cgccgcctac       420
     cgctacaccg ctaccctggg caagaagaag gccgacgacg ccggcctggc ccagctggcc       480
     atcgccggtg acgacgcgca ggccctggcc cagggccagg ccatcgccgc cggtgtcgag       540
     ttcgcccgcg agctgggcaa cctgccgccg aactactgca ccccggccta cctggccgag       600
     gtcggcgtga agttcgccgg cgagcacgac ggtgccgaag ccgagatcct cgacgagcac       660
     cagatggaag cgctgggcat gggctcgctg ctcgccgtgg cccgtggctc ggccaaccgc       720
     ccgcgcctgg tcgtgctgaa gtggaacaat ggcggcgatg ccaagccgta cgtgctggtc       780
     ggcaagggca tcaccttcga taccggtggc gtcaacctga agacccaggg cggcatcgaa       840
     gagatgaagt acgacatgtg cggtggcgcc aacgtcatcg gcaccttcgt cgctgcggtc       900
     aaggccaagc tgccgctgaa cctggtggtg gtggtgccgg cggtcgaaaa cgccatcgac       960
     ggcaacgcct atcgtccgtc cgacgtgatc acctcgatgt cgggcaagac catcgaagtg      1020
     ggcaacaccg acgccgaagg ccgcctgatc ctgtgcgacg ccctgaccta cgcgcagcgc      1080
     ttcgagccgg ccgcgctggt cgacgtcgcc accctgaccg gtgcctgcat ggtcgccctc      1140
     ggccaccaga ccgccggcct gatgagcaag cacgacgacc tggccaatga gctgctggcc      1200
     gccggcgagc aggtgttcga ccgcgcctgg cgcctgccgc tgtgggacga ataccagccg      1260
     atgctggatt cgaccttcgc cgacgtctac aacatcggcg gccgctgggc cggtgcgatc      1320
     accgccggct gcttcctgtc gcgcttcgcc gaaggccagc gctgggccca cctggacatc      1380
     gccggtgtgg ccagcgatga aggcaagcgt ggcatggcca ccggccgccc ggtcggcctg      1440
     ctgagccagt ggctgctgga ccaggccgcc cgcgcctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page