(data stored in ACNUC7421 zone)

EMBL: CP001111.PE540

CP001111.PE540       Location/Qualifiers
FT   CDS_pept        632346..633323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0540"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: xcb:XC_3580 site-specific tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50245"
FT                   /db_xref="GOA:B4SJ77"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ77"
FT                   /protein_id="ACF50245.1"
FT                   /translation="MAPVSTPAERRQLVQQLPELRADDSLRIQRFLDAIWAENGLARAT
FT                   LDSYRRDLEGLARWTDGREGGLAGIERPGLFDYLAWRTRHGWSPRSNARLLSALRAFFA
FT                   DGVRRGDRSEDPSALLDPPKLPRLLPKALAESQIDALLAAPDIDSPLGLRDRAMLELMY
FT                   AAGLRVSELVLLPATAVNLRQGVLRVTGKGSKERLVPLGEESQHWLERYLQQSRPQLVG
FT                   KGKVQALADGQTPLFIEPTLHALTRQAFWHLVKRHAQVAGIDPARISPHALRHSFATHL
FT                   LNRGADLRALQMLLGHSSLSTTQIYTLVAREHLQKLHARHHPRG"
     atggcccctg tttccacccc cgccgaacgc cgccagctgg tgcagcaact gcccgagcta        60
     cgggccgatg acagcctgcg catccagcgc ttcctcgatg cgatctgggc cgagaacggc       120
     ctggcccgcg ccaccctcga cagctaccgg cgcgacctgg aagggttggc acgctggacc       180
     gatgggcgcg agggtggcct ggccggcatt gaacgtcccg ggttgttcga ctacctggcg       240
     tggcgtaccc ggcatggctg gtcgccgcgc agcaacgcgc gcctgctgtc ggcgctgcgc       300
     gcgttcttcg ctgatggtgt gcgccggggc gatcgcagcg aggaccccag tgcactgctg       360
     gatccgccga agctgccgag gctgctgccc aaggcgttgg ccgaaagcca gatcgacgca       420
     ctgctggcgg cgccggacat cgacagcccg ctgggcctgc gcgatcgcgc catgctggag       480
     ctgatgtatg ccgccgggct gcgcgttagc gagctggtgc tgctgccggc cacggcggtc       540
     aacctgcgcc agggagtgtt gcgggtcacc ggcaaaggca gcaaggaacg gctggtgccg       600
     ttgggcgagg agtcgcagca ttggctggag cgctatctgc agcagtcgcg gccgcagctg       660
     gttggcaagg gcaaagtgca ggccttggcc gatgggcaga caccgttgtt catcgagccg       720
     acgctgcatg cgttgacccg gcaggcgttc tggcacctgg tcaagcgcca cgcacaggtg       780
     gccggcatcg atccggcacg gatcagcccg catgccctgc gccacagctt cgccacccac       840
     ctgctcaacc ggggcgcgga tctgcgcgcg ctgcagatgc tgctgggcca cagctcgctg       900
     tcgaccaccc agatctacac gctggtggcg cgcgaacacc tgcagaaact gcacgcccgc       960
     catcacccgc gcggctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page