(data stored in ACNUC7421 zone)

EMBL: CP001111.PE541

CP001111.PE541       Location/Qualifiers
FT   CDS_pept        633424..634215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0541"
FT                   /product="protein disulfide isomerase precursor"
FT                   /note="KEGG: xcv:XCV3675 protein disulfide isomerase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50246"
FT                   /db_xref="GOA:B4SJ78"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ78"
FT                   /protein_id="ACF50246.1"
FT                   /translation="MLRFAIAAVFGALSLTACAQPAPPAAKAPATAAAAKAASPAANGS
FT                   ADQAVRAALTALNPGFEVDYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAK
FT                   GPANSEGLLGYRRDLLAKANHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNR
FT                   NGISVEYLAFPRMGLGSKDYTDMISVWCAADRRQALTSAKRGGSVPAKSCTNPVAMQYA
FT                   LGQQLGVNGTPAIFAPDGTQLGGYLPPAQLRAALEKLSAKR"
     atgctccgat ttgccatcgc cgccgtgttc ggtgcgctca gcctgactgc ctgcgcccag        60
     ccggccccgc cggccgccaa ggcacctgct accgctgctg cggccaaggc tgccagcccg       120
     gctgccaacg gctcggccga ccaggccgtg cgtgccgcgc tgaccgcgct caatccgggt       180
     ttcgaagtgg attacatcgg cgccgcgccg ttccccggct tccgcgaagt ggtggtctcc       240
     ggccagctgc tgtacgtgtc cgatgacggt cgctacctgt tccagtcgca gccctacgac       300
     acccgcgcca agggtccggc caacagcgaa ggcctgctcg gctaccgccg cgatctgctg       360
     gccaaggcca accacggtga ccgcatcgtg ttcgctgcgc ccaatgccaa gtacaccatc       420
     agcgtgttca ccgacatcga atgcggctac tgccgcaagc tgcaccagga tatcgccgag       480
     ctcaaccgca acggcatcag tgtcgagtac ctcgcgttcc cgcgcatggg cctgggcagc       540
     aaggactaca ccgacatgat ctcggtctgg tgtgcggccg atcgtcgcca ggcgctgacc       600
     agcgccaagc gcggtggcag cgtgccggcg aagagctgca ccaacccggt ggcgatgcag       660
     tacgcactgg gccagcagct gggcgtgaac ggtaccccgg cgatcttcgc cccggacggt       720
     acccagctgg gcggctacct gccgccggcg cagctgcgcg ccgcgttgga aaagctgtcg       780
     gccaagcgct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page