(data stored in ACNUC7421 zone)

EMBL: CP001111.PE543

CP001111.PE543       Location/Qualifiers
FT   CDS_pept        637280..641164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0543"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: xcb:XC_3578 phosphoribosylformylglycinamidine
FT                   synthase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50248"
FT                   /db_xref="GOA:B4SJ80"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ80"
FT                   /protein_id="ACF50248.1"
FT                   /translation="MMVLEGAPALSPFRRERLESRLQSIAPSLRISGAWHVYFVQPEGS
FT                   AVPDLTTLCRILEAAPQAEAVAEGAVSRIVVPRLGTLSPWSSKATELVRGAGQPVSRVE
FT                   RGLRIDVQGWPADAAAQQALIKALHDPMTQSVLENVEQGQALFSTPARGELERVPVDQL
FT                   EAANQRLGLAMAQDEIDYLRERFSALGRSPSDVELMMFAQANSEHCRHKIFNASWTIDG
FT                   QEQDRSLFRMIKNTHQQTPQHTLSAYSDNAAVIEGHPASRYRPDPASGEYRSEPSVPSA
FT                   FQIKVETHNHPTAIAPFPGASTGAGGEIRDEGATGRGGKPKAGLSGFSVSHLRIPELPQ
FT                   PWEAPRALNPRMAPALEIMTDGPLGGAAFNNEFGRPALLGYFRSFELPEGADLVRAYDK
FT                   PIMLAGGLGAIDRVQVDKILLQDGDAVIVLGGPAMLIGLGGGAASSVASGESAEDLDFA
FT                   SVQRDNPEMERRCQEVIDRCVAMGADNPIKFFHDVGAGGLSNAIPELLHDSKVGGIIDL
FT                   GKVPTDDPSLSPMQLWCNESQERYVLGVAQERLAEFAALCARERCPFAAVGVATAEEHL
FT                   VVAYGAVPGNIPADAPIDLPMDVLFGKPPKMHRDTAHPPAPRWPALKTGGLDLQEAGLR
FT                   VLAHPTVASKNFLVTIGDRSVGGLTAREQMVGPWQLPVADVAITLADFNGVAGEAMALG
FT                   ERTPLALLDAAASARMAVGEALTNLCAAPVDALDEIKLSANWMAAAGHPGEDALLYDAV
FT                   KAVGMELCPQLDISIPVGKDSLSMQAQWHDQGEAHKSVSPVSLVITAFAPVADVRQQLT
FT                   PLLDREVESELWLIGLGAGKQRLGGSILAQVHADHGDLPAFAGAAPDLDDPQRLRGFFE
FT                   LIRDARQSGLLLAYHDRSDGGAFAALCEMAFTSRLGLDITLDAWGDDPFRSLFNEELGA
FT                   VVQIAREDRAAFADLVERHALTECAQRIAKPTTAPVVRVSLGGENLAEWRWDALFDAWW
FT                   SVTHAMQKRRDNPANADAEREIARAFTAPGLKPKLSFDLNEDVAAPFISTGARPRVAVL
FT                   REQGVNGQIEMANIFERAGFRAFDVHMSDLIEGRVALQDFTGLVACGGFSYGDVLGAGR
FT                   GWATSILERSALRDAFAAFFAREDSFALGVCNGCQMMSQLKGIIPGAEHWPQFRRNASE
FT                   QFEARTALLEVVESPSILLRGMAGSRLQVAVAHGEGQAVFDNAVDQAAARVSLRYIDGN
FT                   GNVASQYPLNPNGSPDGITGLTSTDGRVTIMMPHPERTPRALNMSWAPAEWQGDSPWMR
FT                   MFRNARVWCG"
     atgatggtcc tcgagggcgc gcccgccctg tcgccgttcc gccgcgaacg tcttgaatcc        60
     cgcctgcagt ccatcgctcc ctccctgcgc atcagcggtg cctggcacgt ctacttcgtg       120
     cagcccgaag gcagcgccgt ccccgacctg accacgctgt gccgcatcct cgaagctgcg       180
     ccgcaggccg aggccgtggc cgaaggcgcg gtcagccgca tcgtggtgcc gcgcctgggc       240
     acgctgtcgc cgtggtcgag caaggccacc gaactggtgc gtggtgctgg gcagccggtc       300
     agccgggtcg aacgtggact gcgcatcgac gtgcagggct ggccggccga tgccgccgcc       360
     cagcaggcgc tgatcaaggc gctgcacgac ccgatgacac agtcggtgct ggagaacgtc       420
     gagcagggtc aggccctgtt ctcgaccccg gcccggggtg aactggagcg ggtgccggtg       480
     gaccagctgg aggccgccaa ccagcgcctc ggcctggcca tggcccagga cgagatcgat       540
     tacctgcgcg agcgcttcag cgcgctgggc cgttcgccgt cggacgtgga actgatgatg       600
     ttcgcgcagg ccaactccga gcactgccgc cacaagatct tcaatgccag ctggaccatc       660
     gacggccagg aacaggaccg ttcgctgttc cggatgatca agaacaccca ccagcagacc       720
     ccacagcaca cgctcagcgc gtacagcgac aatgccgcgg tgatcgaagg gcatccggcg       780
     tcgcgttatc gtccggaccc ggccagcggt gagtaccgca gcgagccgag cgtgcccagc       840
     gcgttccaga tcaaggtgga aacgcacaac catccgaccg cgatcgcgcc gttcccgggt       900
     gcttcgaccg gcgccggcgg cgagatccgc gacgaaggcg cgaccggccg cggtggcaag       960
     ccgaaggccg gcctgagcgg cttctcggtc tcgcacctgc gcattcccga gctgccgcag      1020
     ccgtgggagg cgccgcgcgc gctgaacccg cgcatggcgc cggcgctgga aatcatgacc      1080
     gacggcccgc tgggcggcgc tgcgttcaac aacgagttcg gccgcccggc cctgctcggc      1140
     tacttccgca gcttcgagct gccggaaggc gccgacctgg tgcgtgccta cgacaagccg      1200
     atcatgctgg ccggtggcct cggtgcgatc gaccgcgtgc aggtcgacaa gatcctgctg      1260
     caggatggcg atgccgtgat cgtgctcggt ggcccggcga tgctgatcgg cctcggtggc      1320
     ggtgccgcca gctcggtggc ctccggcgaa agcgccgagg acctcgactt cgccagcgtg      1380
     cagcgcgaca acccggaaat ggagcgccgc tgccaggagg tcatcgaccg ctgcgtggcg      1440
     atgggcgccg acaacccgat caagttcttc catgacgtcg gtgccggtgg cctgtccaat      1500
     gccatccccg agctgctgca cgactcgaag gtcggcggca tcatcgatct gggcaaggta      1560
     ccgaccgacg acccgtcgct gtcgccgatg cagttgtggt gcaacgagtc gcaggaacgc      1620
     tatgtgctcg gtgtcgcgca ggagcgcctg gccgagttcg ccgcactgtg tgcccgcgag      1680
     cgctgcccgt tcgccgcggt tggcgtggcc accgccgaag aacacctggt ggtggcctac      1740
     ggcgctgttc cgggcaacat tccggccgat gcgccgatcg acctgccgat ggacgtgctg      1800
     ttcggcaagc cgccgaagat gcaccgcgac accgcacacc cgccggcacc gcgctggccg      1860
     gcgctgaaga ccggcggcct ggacctgcag gaagccggcc tgcgcgtgct cgcgcacccg      1920
     acggtggcat cgaagaactt cctggtcacc atcggcgacc gcagcgttgg tggcctgacc      1980
     gcacgcgagc agatggtcgg cccgtggcaa ttgccggtgg ctgatgtggc aatcaccctg      2040
     gccgacttca acggcgtggc cggtgaagcg atggcgctcg gtgagcgcac cccgctggcg      2100
     ctgctcgatg ccgcagcgtc ggcacgcatg gcggtgggtg aagcattgac caacctgtgc      2160
     gctgcaccgg tcgatgcgct ggacgagatc aagctgtcgg cgaactggat ggccgccgcc      2220
     ggccacccgg gtgaagacgc gctgctgtac gacgcggtga aggcggtggg catggaactg      2280
     tgcccgcagc tggacatcag catcccggtc ggcaaggact cgctgtcgat gcaggcgcag      2340
     tggcacgatc agggcgaggc acacaagagc gtgtcgccgg tgtcgctggt gatcaccgcg      2400
     ttcgcgccgg tcgccgacgt gcgccagcag ttgaccccgc tgctcgatcg cgaagtcgag      2460
     agcgagctgt ggctgatcgg cctcggcgcc ggcaagcagc gcctcggtgg ttcgatcctg      2520
     gcccaggtgc atgccgacca tggcgacctg ccggccttcg ccggtgccgc gccggacctg      2580
     gatgacccgc agcgcctgcg tggcttcttc gaactgatcc gcgatgcgcg ccagtccggg      2640
     ctgctgctgg cctaccacga ccgcagcgac ggtggtgcct tcgccgcact gtgcgaaatg      2700
     gccttcactt cgcgcctggg cctggacatc acccttgatg cctggggcga tgatccgttc      2760
     cgcagcctgt tcaatgaaga actgggtgca gtggtgcaga tcgcgcgcga agaccgtgcg      2820
     gccttcgccg acctggtcga gcgccatgca ctgaccgaat gcgcgcagcg catcgccaag      2880
     ccgaccaccg caccggtggt gcgcgtgtcg ctgggtggcg agaacctggc cgaatggcgc      2940
     tgggacgcgc tgttcgatgc ctggtggtcg gtcacccatg ccatgcagaa gcgccgcgac      3000
     aacccggcca acgccgacgc cgagcgcgaa atcgcgcgtg ccttcacggc gccgggcctg      3060
     aagccgaagc tcagcttcga cctcaacgaa gacgtggccg ctccgttcat cagcaccggt      3120
     gcgcgtccgc gcgtggccgt gctgcgcgag cagggcgtca atggtcagat cgaaatggcg      3180
     aatatcttcg aacgtgcagg cttccgcgcg ttcgacgtgc acatgagcga cctgatcgaa      3240
     ggccgcgtgg cgctgcagga cttcaccggc ctggtcgcct gcggcggctt cagctacggc      3300
     gacgtgctgg gtgccggccg tggctgggcg acctcgatcc tggagcgcag cgcactgcgt      3360
     gatgccttcg ctgcgttctt cgcccgcgag gacagcttcg cgctgggcgt gtgcaacggc      3420
     tgccagatga tgagccagct gaagggcatc atccccggtg ccgagcactg gccgcagttc      3480
     cgccgcaacg ccagcgagca gttcgaagcc cgtaccgcgc tgctggaagt ggtggaatcg      3540
     ccgtcgatcc tgctgcgtgg catggccggc tcgcgcctgc aggtggcggt ggcgcatggt      3600
     gaaggccagg cggtgttcga caacgccgtt gaccaggccg ccgcacgcgt ctcgctgcgc      3660
     tacatcgacg gcaatggcaa cgtcgccagc cagtacccgc tgaacccgaa cggttcgccg      3720
     gacggcatca ccggcctgac cagcaccgac ggccgcgtca ccatcatgat gccgcacccg      3780
     gaacgcaccc cgcgcgcgct caacatgagc tgggccccgg ccgagtggca gggcgattcg      3840
     ccgtggatgc gcatgttccg caacgcgcgg gtgtggtgcg gctga                      3885
//

If you have problems or comments...

PBIL Back to PBIL home page