(data stored in ACNUC7421 zone)

EMBL: CP001111.PE544

CP001111.PE544       Location/Qualifiers
FT   CDS_pept        641603..648781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0544"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   xac:XAC3546 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50249"
FT                   /db_xref="GOA:B4SJ81"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ81"
FT                   /protein_id="ACF50249.1"
FT                   /translation="MNRIYRKVWNKALGQLVVASELASSGSSGGVVDQRRDATQAAPAR
FT                   LAMALGLVLGLGMSGIAAAQSVQIGGSATCVAFSGKLLEKCLIEGTATAKGSNAVAIGS
FT                   NSSASAANSVALGAGSKATRANTVSVGDTGKERQITNVAAGSQATDAVNKAQLDAQARA
FT                   TQAALADVAADGNRYFKADGAGDDSDAAKIEGQGAVAAGAGAQSLANATTAIGTQAIAA
FT                   GIGASAFGQGALALGDASVVVGQSAAAFGLGDTAVGASATASSENGAATALGALSEATA
FT                   DGATAVGGGAVAMGPGSTALGRGATAANEASIAVGAFSTAVGEYSTALGSNSAAVATGS
FT                   VALGAGSLADRVDTVSVGAAEYGLTRQITSVAAGTEDNDAVNVGQLKGVAAVADATAKR
FT                   FQATGSSNSDAGALAEGDDALAAGEAANAIGNGATAVGAGAGAVAQNATAVGNNALASG
FT                   QNSAAFGNNAQANGPGSVAVGGAAVDANGNPLITSGGVPVETGATSAGVGGTAVGASAE
FT                   ASGFAASSYGVGAYAAGAQASAFGAVANAIGDYSTALGTQSNATGTSSVAIGGPADLIP
FT                   GLGFFVQTQASGEAATAVGAGAIASGDRAVANGSLSEASGAEATAVGYFAYAPGENASA
FT                   LGAQTWASGAQSTAVGYYATARGANSVALGANSEAVRANSVAVGSAGNERQITSVAAGS
FT                   EATDAVNKAQLDAVANTADTTARFFQAQPEAGSDAGALADGEGAIAAGSSSNAIGAGAI
FT                   AHGAAASAIGDDSVAVGRNSAATGNGGVAIGGLGQAYDEFNQPIIGADGKAQQVGTTAV
FT                   ADATAVGSGAQATGATSTAFGNAAKASGDNSFAAGGKSRATGSYAVAVGDSAFASSDDS
FT                   TAVGGYSWATASGAAAFGSGAWATATNASAFGNAAWASGSGATSIGYNSWANGASSTAV
FT                   GRGAFGYGDNSVALGFQALGNSINSIAIGTNTVAGGESAIALGAGSNASASNTVALGAG
FT                   SVANRARTVSVGSAGNERQVTNVAAGTQATDAVNKAQLDAVAATATTTSRFFQASGNGD
FT                   DVAGALVDGDNALAAGDAANAIGNGATALGSGANALASNAQAVGFNALASAANASAVGA
FT                   NAQATGEYATAHGAESEASGEQSAAFGAASIASGAGSTATGVLSEASGEEAVAVGYFSN
FT                   ASGDAATAVGSESVASGTASAAFGIGAEASGGYSTAIGGYAQASAFNATAFGNFANASG
FT                   SNSVAVGGDSEASGAYSTATGQGSLATGTNSVAVGGSLFGVLATEASGNYSTAVGGGAW
FT                   SGGINSTALGNAAESRGANSVALGADSIADRDNTVSVGGGGNTRQITNVADGTQGNDAV
FT                   NKNQLDAVAAAAEKTSKQFQASGNADGETGALVEGDNALAAGDAANAIGNGATALGSGA
FT                   NALAANATAVGIDALATGSNAAALGSTAQATGEDSLALGTGASASELGASAVGARAQAS
FT                   GAYSMATGTEANASGTQALASGFRSAASADGTTAVGGYAEASGRLGTALGYGSAASGAN
FT                   TTAVGFGAAAAGTGAVAVGQSSEASGEESVAIGGSTFFGLIPSRASGTGAAAFGAGAWA
FT                   TEDYATAIGWNSWAAGGSATALGANATANGSNSVALGAGSKADRDNTVAVGKAGGERQV
FT                   THVAAGSEATDAVNKGQLDAVASVADKTSRQFQASGNADGEAGALVDGDNALAAGNAAN
FT                   AIGNGATALGSGANAMAANATAVGFDALATGNNAAALGNTAQASGVDSVALGSGASASE
FT                   LGASATGAGAQAKGAYSTASGAQATASGTQSQANGFRASASADGASAIGSYADASGRLG
FT                   TAVGYGSKATGANATAVGVSANASAAGSVALGAGSVADRANTVSVGSASSDRQITRVAA
FT                   GTERTDAVNRGQLDAVAATADGTARYVKATGSGTASASGTDAAAIGSAASASGARSNAL
FT                   GANALAIGNGALALGTSAGATGANSVALGAGSRALDANVVSVGGGNGTDGPATRRIVNV
FT                   ADGRIAAGSTDAITGSQLNVTNQRVGAVETRVGDFDSRITTVETTAASAVGYDDASRDR
FT                   LTLSGFQGTTIDNVGAGSIAAGSRQAINGGQLFQSLSDAASFLGGGASVGMQGVFVAPN
FT                   YVIQGATYSNVGDALGALDRKVSEIDRRSAGGTRAGASSLRAMSASLDDTSLASTADAP
FT                   VAADAAAASTARVQGTPTAAAAGAGIPVGTPGSGANSVTVGDGAVASGASSTAIGQGAT
FT                   ATATNAIALGQGSLADRANTISVGSEGNERQVTNVAAGTTATDAVNKGQLDRGMATANS
FT                   YTDSRVQAVTDSFDVFKGEIDGRLRHMDRRIDRQGAMSAAMLNMATSAAGIRTQNRVGV
FT                   GIGFQGGESALSLGYQRAISDRATVTFGGAFSSDDSSVGVGAGFGW"
     atgaatcgga tttatcgcaa ggtctggaac aaagcattgg gtcagttggt ggtggcctcg        60
     gaactggcct cctccggcag cagcggcggg gtcgtcgacc agcgccgcga tgcaacgcag       120
     gctgcgcccg cacggttggc gatggcactg ggcctggtat tgggattggg catgagcggt       180
     atcgctgcgg cacagtcggt gcagatcggc ggcagcgcca cctgcgtcgc attcagcggc       240
     aagctgctcg aaaagtgcct gatcgaaggc acggctacgg ccaagggcag caacgcggtg       300
     gcgatcggca gcaacagcag cgccagtgct gccaatagcg tggcgctcgg cgccggctcc       360
     aaggccaccc gtgcaaacac cgtgtccgtc ggtgacaccg gcaaggaacg gcagatcacc       420
     aatgttgctg caggcagcca ggccaccgat gcggtgaaca aggcgcagct cgatgcgcag       480
     gcgcgtgcaa cgcaggccgc gcttgccgat gtcgccgcag acggcaaccg ttatttcaag       540
     gccgacggcg caggcgatga cagcgacgcg gcgaagatcg aagggcaggg cgccgtggcg       600
     gccggtgccg gcgcacagtc gctggccaat gcgaccaccg ccatcggtac ccaggccatc       660
     gctgccggca tcggcgcgag tgcgttcggc caaggcgcac tcgcgctcgg cgatgccagc       720
     gtcgtggtcg ggcagagtgc cgcggcattc ggtctcggcg acaccgcggt tggcgcaagc       780
     gctaccgcat ccagcgagaa cggcgcggcc accgcactcg gcgcgctgtc cgaagccacc       840
     gctgatggtg cgacggccgt cggcggcggt gccgtggcga tgggcccggg cagcaccgca       900
     ctgggccgcg gcgctaccgc cgccaacgaa gcgtcgatcg cggttggcgc gttcagcacc       960
     gccgtcggtg aatacagcac ggcgctgggc tcgaactccg ctgcggtggc taccggcagc      1020
     gtggcgctcg gcgccggctc actggccgat cgtgtcgata ccgtgtccgt cggtgccgcc      1080
     gaatacggcc tgacccgcca gatcaccagc gtggctgccg gtacggaaga taacgatgcg      1140
     gtcaacgtcg gccagttgaa gggcgttgcc gccgtggccg atgctaccgc caagcgcttc      1200
     caggccaccg gcagcagtaa cagcgatgcc ggtgcgctgg ccgagggcga cgacgcactg      1260
     gctgcaggcg aggccgccaa cgcgatcggc aacggtgcta ctgcagttgg cgcgggtgcc      1320
     ggcgccgtcg cgcagaacgc caccgccgtc ggcaacaacg cgctggcctc gggccagaac      1380
     agtgcagcgt tcggcaacaa cgcacaggcc aacggcccgg gcagcgttgc cgtgggcggt      1440
     gccgcggtgg acgccaacgg caacccgctg atcaccagcg gcggcgtacc ggtggaaacc      1500
     ggcgccacca gcgccggcgt cggtggcact gccgtcggtg ccagcgctga agccagcggc      1560
     tttgccgcgt cgtcctacgg cgtgggtgcc tatgctgccg gcgcacaggc gtcggcgttc      1620
     ggtgcggtgg ccaatgccat cggcgattac tccacggcat tgggtacgca gagcaatgcc      1680
     accggcacca gcagcgtcgc catcggcggc ccggctgatc tgatccccgg tctgggcttc      1740
     ttcgtgcaga cccaggccag tggcgaagcc gcgaccgccg tcggcgcggg cgccattgcc      1800
     agtggcgatc gcgcggtggc caacggcagc ctgagcgagg cctccggtgc cgaagccact      1860
     gcggtcggct acttcgccta tgcacctggc gagaacgcca gtgccctcgg cgctcagacc      1920
     tgggccagtg gcgcacagag cactgcggtg ggttactacg ccaccgcacg tggcgccaac      1980
     agcgtcgcgc tcggcgccaa ctccgaagcg gtgcgcgcca acagcgtggc ggtgggcagt      2040
     gccggcaacg aacggcagat caccagcgtt gccgccggca gcgaagccac cgatgcggtg      2100
     aacaaggcgc agttggatgc ggtggccaat accgccgaca ccaccgcgcg gttcttccag      2160
     gcgcagccgg aagctggcag cgatgccggc gcgctggccg atggcgaggg cgccatcgcc      2220
     gccggttcgt cgagcaatgc gatcggtgcg ggtgccatcg cgcatggtgc ggctgcatcc      2280
     gcgatcggcg atgacagtgt ggcggtcggc cgcaacagcg cggccaccgg caatggcggt      2340
     gtcgccatcg gtggcctcgg ccaggcctac gatgaattca accagccgat catcggtgcc      2400
     gacggcaagg cacaacaggt cggcaccacc gccgttgccg atgccaccgc agtcggcagc      2460
     ggtgcgcagg ccaccggagc caccagcact gccttcggca atgccgccaa ggccagtggt      2520
     gacaacagct tcgccgccgg cggcaagtca cgtgccaccg gcagctatgc ggttgcagtc      2580
     ggcgacagcg cgttcgccag cagcgatgac agcaccgccg tcggtggtta cagctgggcg      2640
     accgccagtg gcgcagcagc attcggttcg ggtgcatggg ccaccgccac caacgcgtcg      2700
     gcgttcggca acgcggcgtg ggccagcggc agcggcgcaa cgtccatcgg ttacaacagt      2760
     tgggccaacg gtgccagctc caccgccgtc ggtcgcgggg ccttcggcta tggcgacaac      2820
     agcgtggcgt tgggcttcca ggcgttgggc aacagcatca acagcatcgc catcggcacc      2880
     aacacggtgg ccggtggtga gagtgcgatc gcgctcggtg ccggcagcaa tgccagcgcc      2940
     agcaacacgg tcgcgctggg cgctggttcg gtcgccaacc gcgcgcgcac ggtgtcggtg      3000
     ggcagcgctg gcaacgaacg ccaggtcacc aacgtcgccg ccggcaccca ggccaccgat      3060
     gcggtgaaca aggcgcagct ggatgcggtt gcggccacgg ccacaaccac cagtcgcttc      3120
     ttccaggcca gcggcaatgg cgatgacgta gccggtgcgc tcgtggacgg tgacaacgca      3180
     ctggccgccg gtgatgcggc caatgccatc ggcaatggcg ccactgcgct gggcagcggc      3240
     gccaatgcgt tggccagcaa tgcgcaggcg gtgggcttca atgccctggc cagcgcggcc      3300
     aatgccagcg ccgtcggcgc caacgcacag gccaccggtg agtacgccac cgcgcacggt      3360
     gcggaaagcg aggccagcgg cgagcagagc gcggcgttcg gtgcggccag catcgccagc      3420
     ggtgccggca gtaccgctac cggcgtgctg tccgaagcct ctggcgaaga agccgtggct      3480
     gtgggttact tcagcaatgc cagcggtgac gcggcaaccg ccgtgggtag cgaaagcgtg      3540
     gccagtggca cggcgtcagc ggccttcggt atcggtgccg aagccagcgg cggttacagc      3600
     accgccatcg gtggctacgc acaggcctcg gcgttcaacg ccacggcgtt cggcaacttc      3660
     gccaatgcat ccggttccaa cagtgtggca gtgggtggcg attcggaagc ctccggtgcc      3720
     tacagcaccg ccaccggcca gggcagcctg gccaccggca ccaacagcgt cgccgttggc      3780
     ggctcgctgt tcggcgtgct ggccaccgag gcatcgggca actactccac tgcggtgggt      3840
     ggtggcgcct ggtcgggggg catcaacagc accgcactgg gcaacgccgc cgaatcgcgc      3900
     ggtgccaaca gcgtggcgct gggtgcggac tcgattgccg accgcgacaa caccgtgtcg      3960
     gtgggcggcg gcggcaatac ccgccagatc accaacgtgg ccgatggcac ccagggcaac      4020
     gacgcggtca acaagaacca gctcgatgcg gtggccgctg cggcggaaaa gaccagcaag      4080
     cagttccagg ccagtggcaa tgccgatggc gaaaccgggg cgctggtcga gggtgacaac      4140
     gcgctggccg caggtgacgc cgccaatgcc atcggcaacg gcgccaccgc gctgggcagt      4200
     ggtgccaatg cgctcgcggc caacgccacg gcggtaggca tcgatgcgct ggccaccggc      4260
     agcaacgcgg ctgccctggg cagcacggca caggccaccg gcgaagacag cctggcgctc      4320
     ggcaccggcg ccagcgccag tgaactgggg gcaagcgcgg tcggcgcgcg cgcgcaggcc      4380
     agcggtgcat acagcatggc cacaggtaca gaagccaatg ccagcggcac ccaggcattg      4440
     gccagcggtt tccgcagcgc cgcgtccgcc gatggcacta ccgctgtcgg cggctacgcc      4500
     gaagccagcg gtcgcctcgg caccgcgttg ggctacggct cggcggccag tggtgccaac      4560
     accaccgcag tcggtttcgg tgccgctgcg gccggaaccg gtgccgttgc cgtgggtcag      4620
     tccagcgagg ccagtggcga ggagagcgtg gccatcggtg gcagcacctt cttcggcctg      4680
     atcccctcgc gtgccagtgg caccggtgcc gcggcattcg gtgcgggcgc gtgggccacc      4740
     gaagactacg ccacggcgat cggctggaat tcgtgggcgg caggcggcag cgccaccgca      4800
     ctgggtgcca atgccaccgc caatggcagc aacagcgtcg cgctcggcgc cggttccaag      4860
     gccgaccgtg acaacacggt ggccgtcggc aaggcgggcg gtgagcgcca ggtaacccat      4920
     gtcgcagcag gcagcgaagc caccgatgcg gtgaacaagg gccagctgga tgcagtggcc      4980
     agcgtcgccg acaagaccag ccgccagttc caggccagcg gcaatgccga tggcgaggcc      5040
     ggtgcactgg tggacggtga caacgcactg gctgccggta atgcggccaa cgccatcggc      5100
     aacggcgcca ccgcactggg cagcggtgcc aacgcgatgg cggccaatgc caccgcggtg      5160
     ggcttcgatg cgctggccac cggcaacaat gccgctgcac tgggtaacac ggcgcaggcc      5220
     agcggtgtcg acagcgtcgc cctcggcagt ggcgccagtg ccagtgagct gggtgccagc      5280
     gccaccggtg ccggcgccca ggccaagggc gcctacagca ccgccagcgg tgcgcaggcc      5340
     accgccagcg gcacgcagtc gcaggccaat ggtttccgcg ccagcgcgtc ggccgacggc      5400
     gcatcggcca tcggtagcta cgccgatgcc agcggccgtc ttggcaccgc agtcggttat      5460
     ggcagcaagg ccaccggcgc caacgcgacg gcggttggtg tcagcgccaa tgccagcgct      5520
     gccggcagcg tcgcgctggg tgctggttcg gttgccgacc gtgccaacac cgtgtcggtc      5580
     ggcagtgcca gcagcgatcg ccagatcacc cgtgtcgccg ccggtaccga gcgtaccgat      5640
     gcggtcaacc gtggccagct ggatgccgtt gccgccaccg cagacggcac ggcgcgctac      5700
     gtcaaggcca ccggcagcgg cacggccagc gccagcggta ccgacgccgc agccatcggt      5760
     tcggcagcca gcgccagtgg tgcgcgcagc aacgcgctgg gtgccaatgc gctggccatc      5820
     ggcaacggtg cattggccct gggtaccagc gccggtgcaa cgggtgccaa ctcggtcgcg      5880
     ctcggcgcgg gttcgcgagc gctcgatgcc aacgtggtgt cggtcggtgg tggcaacggc      5940
     accgatggtc cggccacgcg ccgcatcgtc aatgtggccg atggccgcat cgccgccggc      6000
     agcaccgatg cgatcaccgg ttcgcagctc aacgtcacca accagcgcgt gggcgcggtg      6060
     gaaacccgcg tcggtgattt cgattcgcgc atcaccaccg ttgaaaccac ggcggccagc      6120
     gcggtgggct acgacgacgc cagccgtgat cgcctgaccc tgtccggctt ccagggcacc      6180
     accatcgaca acgtcggtgc aggcagcatt gccgccggca gccgtcaggc gatcaacggc      6240
     ggccagttgt tccagtcgct cagtgatgca gccagcttcc tcggtggtgg tgccagcgtc      6300
     ggtatgcagg gcgtgttcgt ggcgccgaac tatgtgatcc agggcgccac ctacagcaac      6360
     gtcggcgatg cattgggtgc gctggaccgc aaggtcagcg agatcgaccg ccgcagcgcc      6420
     ggtggcacgc gtgccggtgc gtccagcctg cgcgcgatga gcgcctcgct ggatgacact      6480
     tcgttggcca gcactgccga tgccccggtg gcggcggatg cggcagcggc cagcaccgca      6540
     cgcgtgcagg gcacgccgac ggctgccgca gcaggtgccg gcattccggt gggtacgccg      6600
     ggaagcggcg ccaactcggt cactgtgggt gatggcgccg tggccagcgg ggcttcctcg      6660
     accgcgatcg gccagggcgc taccgccaca gcaaccaacg ccattgcatt gggccagggc      6720
     tcgctcgccg accgtgccaa tacgatctcg gtgggcagcg agggcaacga gcgccaggtc      6780
     accaacgtgg cggccggtac cacggctacc gatgcggtca acaagggcca gcttgatcgt      6840
     ggcatggcca cggccaacag ctacaccgac agccgcgtcc aggccgtcac cgacagcttc      6900
     gatgtgttca agggcgagat cgacggacgc ctgcgccaca tggatcgccg catcgaccgc      6960
     cagggcgcga tgagcgctgc aatgctcaac atggccacca gtgctgccgg tatccgtacc      7020
     cagaaccggg tcggcgtcgg catcggtttc cagggcggcg aatcggcgtt gtcgctgggc      7080
     taccagcgtg cgatcagcga tcgcgccacg gtcaccttcg gcggtgcctt cagcagtgac      7140
     gacagctcgg ttggcgtcgg tgccggcttc ggctggtaa                             7179
//

If you have problems or comments...

PBIL Back to PBIL home page