(data stored in ACNUC7421 zone)

EMBL: CP001111.PE546

CP001111.PE546       Location/Qualifiers
FT   CDS_pept        650930..652651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0546"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: xom:XOO_0771 general secretion pathway protein
FT                   E; TIGRFAM: general secretory pathway protein E; PFAM: type
FT                   II secretion system protein E; General secretory system II
FT                   protein E domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50251"
FT                   /db_xref="GOA:B4SJ83"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ83"
FT                   /protein_id="ACF50251.1"
FT                   /translation="MNALAATAADTAEGRILDALLARGRLKEGDLARARPLHAEAGGSL
FT                   LGLLVRLGLVSERDQAQASAEVLGLPLLEGKQLPEAPPQGLAEGLPLSVRFLKQFHVCP
FT                   LALDEQGVRLWLADAHDPYPQQAVQLALGVPVTPVLGMRAEIDDLVERWFGQGRSAMGA
FT                   IVETADGEGGAVDDIEHLRDLASEAPVIRLVNLVIQRAVELRASDIHVEPFESRLKVRY
FT                   RIDGVLVEGESPPANLTAAVISRIKIMARLNIAERRLPQDGRIMLRVQGKELDLRVSTV
FT                   PTAHGESVVMRLLDRETVVFDFHRLGFTDVFLPQFRKVLEQPHGILLVTGPTGSGKTTT
FT                   LYTALSQLNTADVKIITVEDPVEYQIEGINQIQAKPQIGLDFANALRSIVRQDPDIIMI
FT                   GEMRDLETARIAIQSALTGHLVLSTLHTNNAAGGITRLLDMGVEDYLLTSTINGILAQR
FT                   LVRRLEPTHAERYEASPEEVERFELRRLQPQGPIHLYRPKPSALAPTGYLGRTTIMEFL
FT                   VMNDALRRAVMRRDGMGEIERIAREAGMRTMYEDGLSKALSGQTTIEEVLRVTEES"
     gtgaacgcgc ttgctgcaac cgccgccgac accgccgaag gtcgcatcct ggatgcgctg        60
     ctggcgcgtg gccggctcaa ggaaggcgat ctggcacggg cgcggccgct gcatgccgaa       120
     gccggtggca gcctgctcgg cctgctggtg cggctggggc tggtctccga gcgtgaccag       180
     gcgcaggcca gcgccgaggt gctggggctg ccgctgctgg agggcaagca gctgcccgag       240
     gcaccgccgc aggggctggc cgagggcctg ccgctgtcgg tgcgcttcct caagcagttc       300
     catgtgtgcc cgttggcgct ggatgaacag ggcgtgcggc tgtggctggc cgatgcccac       360
     gatccctatc cgcagcaggc cgtgcagctg gcattgggcg taccagtgac gccggtgctg       420
     ggcatgcgcg cggagatcga tgatctggtc gagcgctggt tcggccaggg ccgcagtgcg       480
     atgggcgcga ttgtcgagac cgccgacggt gagggtgggg cggtggacga catcgaacac       540
     ctgcgcgacc tcgcctcgga agcgccggtg atccgcctgg tcaacctggt gatccagcgc       600
     gcggtagagc tgcgtgcctc ggacatccat gtcgaaccct tcgaaagccg gttgaaggtg       660
     cgttaccgca tcgacggcgt gctggtggaa ggcgagagcc cgccggccaa cctcaccgct       720
     gcggtgatca gccgcatcaa gatcatggcc cggctcaaca tcgccgagcg ccgcctgccg       780
     caggacggcc gcatcatgct gcgcgtgcag ggcaaggaac tggacctgcg cgtgagcacg       840
     gtgccgaccg cacacggcga aagcgtggtg atgcgcctgc tcgaccgcga aaccgtggtc       900
     ttcgatttcc accggctcgg cttcaccgat gtcttcctgc cgcagttccg caaagtgctg       960
     gaacagccgc acggcatcct gctggtgacc ggccccaccg gttcgggcaa gaccaccacg      1020
     ctgtacaccg cgctgagcca gctcaatacc gccgacgtca agatcatcac ggtcgaagac      1080
     ccggtcgagt accagatcga gggcatcaac cagatccagg ccaagccgca gatcgggctg      1140
     gacttcgcca atgccctgcg cagcatcgtg cgccaggacc cggacatcat catgatcggc      1200
     gaaatgcgtg acctggaaac cgcgcgcatc gcgatccagt cggcgctgac cggccatctg      1260
     gtgctgtcca ccctgcatac caacaacgca gccggcggca tcacccgcct gctcgacatg      1320
     ggggtggagg actatctgct cacctccacc atcaacggca tccttgccca gcgcctggtg      1380
     cgccggctgg aaccgaccca cgccgagcgc tatgaagcct cgccggaaga agtcgaacgc      1440
     ttcgaactgc gccggctgca gccgcagggg ccgatccacc tgtaccgccc gaaaccctcg      1500
     gcgctggcac cgaccggcta cctgggacgc accaccatca tggaattcct ggtgatgaac      1560
     gacgcgctgc ggcgtgcggt gatgcgccgt gatggcatgg gcgagatcga gcgcatcgcc      1620
     cgcgaagccg gcatgcgcac catgtacgag gatggcctgt ccaaggcgct gagcgggcag      1680
     acgaccatcg aggaagtgct gcgcgtgacc gaggaaagct ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page