(data stored in ACNUC7421 zone)

EMBL: CP001111.PE549

CP001111.PE549       Location/Qualifiers
FT   CDS_pept        654396..654890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0549"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   xac:XAC3541 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50254"
FT                   /db_xref="GOA:B4SJ86"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ86"
FT                   /protein_id="ACF50254.1"
FT                   /translation="MTYFLPRRLPRPRLHGRRAAGLSLLEMLLVIALIAAIGLITAAGL
FT                   SRGFAGMQLRSAGKDIANQLRVVRAQAIARGEPQRFVIEPARRHWEGANQRHGDVPAQL
FT                   QVQFEGAAQLATAPGQGVIEFHPDGGSSGGRIRLQRDGAEWRIDVGWLTGEVRSGPWRA
FT                   Q"
     atgacgtatt tcctgccgcg ccggctgcct cgcccgcgcc tgcacggcag gcgcgcagcg        60
     ggcctgtcgc tgctggaaat gctgctggtg atcgccctga tcgcagcaat tggcctgatc       120
     actgctgccg gcctgtcacg tggcttcgct ggcatgcaac tgcgcagcgc cggcaaggac       180
     atcgccaacc agctgcgggt ggtacgggcg caggcgatcg cccggggcga accgcagcgc       240
     ttcgtgatcg aaccggcgcg acgccactgg gaaggcgcca accagcgcca tggtgacgtg       300
     ccggcacagc tgcaggtgca gttcgaaggc gccgcgcagc tggccaccgc gccagggcag       360
     ggcgtgatcg agttccatcc cgatggtggt tccagcggtg gccgcatccg cctgcagcgc       420
     gacggtgccg agtggcgcat cgatgttggc tggctgaccg gcgaagtgcg ctccggccca       480
     tggcgggcgc aatga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page