(data stored in ACNUC7421 zone)

EMBL: CP001111.PE557

CP001111.PE557       Location/Qualifiers
FT   CDS_pept        662294..663148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50262"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ94"
FT                   /protein_id="ACF50262.1"
FT                   /translation="MGAIVLLPLCVDDAALDRCLAALDAGTAPGTAVWLADDAQTGPRA
FT                   QAVVEHWLAHTPLQAEYTRRARPLGEVAHLDEMLRACEGLDVAVLAPDSVPAPGWLQQL
FT                   QDAFARDAAIATATPWCNAGETAAWPRLGEINPEPEDPALLAHTCATLPVLHPELPSAV
FT                   THAVLVRGNARRRAGGLDVESYAGWNAALVDLSLRMAGLGWRNVLCETAFVGRAGEAVS
FT                   RDGDLEALAARWPAWVPRLADFLMHDPLHGLRADLQQRMRQAIMPAEQGDLFVSSSAPE
FT                   PPA"
     atgggggcga tcgtgttgtt gccgctgtgc gtggacgatg ccgcgctcga ccgctgcctg        60
     gccgcgctgg atgccggcac cgcgccgggt accgcggtct ggctggccga tgacgcgcag       120
     accgggccgc gtgcgcaggc ggtggtggaa cactggttgg cgcatacgcc gttgcaggcc       180
     gaatacaccc gccgcgcgcg gccgttgggc gaggtcgccc atctggatga gatgctgcgc       240
     gcctgcgagg gcctggacgt ggccgtgctg gcgccggaca gcgtgccagc acccggctgg       300
     ctgcagcagc tgcaggatgc cttcgcccgc gacgccgcca tcgccaccgc aacaccgtgg       360
     tgcaatgccg gcgaaacagc cgcgtggccg cgattgggcg aaatcaatcc cgaaccggag       420
     gacccggcgc tgctggcaca cacctgtgcc acgctgccgg tgctgcatcc ggagctgccc       480
     tcggcagtca cccacgcggt gctggtgcgc ggcaacgcgc gccggcgtgc cggcggcctg       540
     gacgtggaga gctacgccgg ctggaacgcg gcgctggtcg acctgagcct gcgcatggcc       600
     gggctgggtt ggcgcaacgt cctgtgcgag accgccttcg tcggccgcgc aggggaggcc       660
     gtcagccgcg atggcgatct tgaagccctg gccgcgcgct ggccggcctg ggtgccgcga       720
     ctggccgatt tcctgatgca cgatccgctg cacgggttgc gcgccgatct gcagcagcgc       780
     atgcggcagg cgataatgcc ggccgagcag ggcgacctgt tcgtctcgtc ttccgcgccg       840
     gagcctcctg cttga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page