(data stored in ACNUC7421 zone)

EMBL: CP001111.PE561

CP001111.PE561       Location/Qualifiers
FT   CDS_pept        666100..666639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0561"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: aby:ABAYE1856 putative
FT                   fimbrial protein precursor (pilin)"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50266"
FT                   /db_xref="GOA:B4SJ98"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJ98"
FT                   /protein_id="ACF50266.1"
FT                   /translation="MHKINLIAAVMLAAAPLAANAADGTITFNGKVTDKTCTISTPGGK
FT                   DFAVNLPTVSKNTLANAGAVAGRTPFAINLTKCSAGNVATYFEPGSTVDFNTGRLLNQA
FT                   SANAATNVQLQLLGSNNQVLPIKAAGAGLAQTNSQWVTVGTDGSADLSYYAEYYATAAA
FT                   TPGDVTSSVKYTIIYN"
     atgcacaaga tcaatctcat cgccgctgtg atgctggccg ccgctccgct ggccgccaac        60
     gccgccgacg gcaccatcac cttcaatggc aaggtgaccg acaagacctg caccatctcg       120
     accccgggcg gcaaggactt cgccgtcaac ctgccgaccg tgtccaagaa caccctggcc       180
     aatgccggtg ccgttgcggg tcgtaccccg ttcgcgatca acctgaccaa gtgcagcgcc       240
     ggcaacgtcg cgacctactt cgagccgggt tcgaccgttg acttcaacac cggccgcctg       300
     ctgaaccagg cttcggccaa cgctgccacc aacgtgcagc tgcagctgct gggctccaac       360
     aaccaggtcc tgccgatcaa ggcagccggc gctggcctgg cccagaccaa ctcgcagtgg       420
     gtcaccgtcg gcaccgacgg ctcggccgac ctgagctact acgctgagta ctacgccact       480
     gccgccgcca ccccgggcga cgtcaccagc agcgtcaagt acacgatcat ctacaactga       540
//

If you have problems or comments...

PBIL Back to PBIL home page