(data stored in ACNUC7421 zone)

EMBL: CP001111.PE563

CP001111.PE563       Location/Qualifiers
FT   CDS_pept        667528..670113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0563"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: xfm:Xfasm12_0063 outer membrane usher
FT                   protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50268"
FT                   /db_xref="GOA:B4SJA0"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA0"
FT                   /protein_id="ACF50268.1"
FT                   /translation="MIGNRLTLSIHQALCLLVAGVACPGWALAAPANLGEQALMAQSGA
FT                   ANARAPESAQFNSSFLSGQAKQVDLAAFSNGNPMVAGTYRVDVYVNGAWQGRRDLQFKA
FT                   DAQGRVDACLPLPMLEEMGVDSEAVLLQQDPSVPADKTSCVPVQQRMSNAYGIYDSGNL
FT                   RYDLSIPQVFLRREARGYVNPALWDRGINAGFVGYSFNAINSDSRVEGGQRNRSAYLGL
FT                   NAGLNLGGWQFRHDSNLTWSEGDGRHWQSIATYAQRGIPQVRGMLTIGEAYTTGELFDS
FT                   IGYRGASLASDDRMLPDSLRGYAPVVRGIAETNARVEVRQNQQLIYSSTVSPGSFVIDD
FT                   LYPTGYGGDLEVSVIEADGRRREFKVPFGSVPQMLREGVSRYSLTAGQVRNKLLADEPW
FT                   LVQGTYQRGIGNQLTLYGGSALSDGYLSLLYGVGLSTPVGAFAADVTHARTTFDHYGNH
FT                   TGASVRLSYSNMIGETGTNLTLAAYRYSTEGFYSLQDALYGRDSDKRGIDPTTRGRQRS
FT                   QFQVTLNQPLGRRGGALYVTGSVRDFYDRPGTSKQYQVGYNNAWRSVNYGFSALRTEEG
FT                   LLGRSDTQYLLSMSVPLGRGTHPVSFSADVGVRDRGGYDNSRVGITGSAGVDNNFSYGA
FT                   ALSDSREGGTTAVGNAEYRSRYTALNATYSHSRDFRQASVGANGSVVVHPGGFTFTPQR
FT                   GDTMVLVEAPGARDAIVSNAPGLRVDGRGYAVVPYVSPYRLNTVTLDPQGMAHDVELES
FT                   TSQSVAPFAGAISYLRFDTRKGNALLIQVRNTDGRTLPFGAQVKDEQGQPVGMVSQGGR
FT                   LYVRSEKNQGQLQVEWGAGADQRCTIDYQVPAGADASKTGFIPLEAACR"
     gtgatcggaa acagattgac attgtcgatc catcaggcgc tttgcctgtt ggttgctggc        60
     gtggcctgcc caggatgggc gctggctgcc ccggccaatc tcggcgaaca ggcgctgatg       120
     gcgcagagtg gtgcggccaa tgcgcgtgca ccggaatcgg cccagttcaa ctccagcttc       180
     ctgtctggcc aggccaagca ggtcgatctg gcggccttca gcaacggcaa cccgatggtg       240
     gccggcacct atcgcgtcga cgtctacgtc aacggtgcct ggcagggccg tcgcgatctg       300
     cagttcaagg ccgatgcgca gggccgtgtc gacgcctgcc tgccgctgcc gatgctggaa       360
     gaaatgggcg tggacagcga ggccgtgctg ctgcagcagg acccgtccgt gccggccgac       420
     aagaccagct gcgtgccggt gcagcagcgc atgagcaacg cctacggcat ctatgacagc       480
     ggcaacctgc gctacgacct cagcattccg caggtgttcc tgcgccgcga ggcgcgcggc       540
     tacgtcaatc cggcactgtg ggaccgtggc atcaatgccg gcttcgtcgg ctacagcttc       600
     aatgcgatca acagcgacag ccgcgtcgaa ggtggccagc gcaaccgcag tgcctacctc       660
     ggcctcaatg ccggcctgaa cctgggcggc tggcagttcc gccacgactc gaacctgacc       720
     tggtccgagg gtgacggccg ccattggcag agcatcgcca cctacgcaca gcgcggtatc       780
     ccgcaggtgc gcggcatgct caccatcggt gaggcctaca ccaccggtga actgttcgat       840
     tcgatcggct atcgcggcgc cagcctggcc agcgatgacc gcatgctgcc cgactcgctg       900
     cgcggttatg cgccggtcgt gcgcggcatc gccgaaacca acgcacgcgt tgaagtgcgc       960
     cagaaccagc agctgatcta ctcctccacc gtgtcgccgg gcagcttcgt catcgacgat      1020
     ctgtacccga ccggctacgg cggcgacctg gaagtgagcg tgatcgaggc cgatggccgc      1080
     cgccgcgaat tcaaggtgcc gttcggttcg gtgccgcaga tgctgcgcga aggcgtgtcg      1140
     cgttactcgc tgacggccgg ccaggtgcgc aacaagctgc tggccgatga gccgtggctg      1200
     gtgcagggta cctaccagcg cggtatcggc aaccagctga ccctgtacgg cggcagtgca      1260
     ctgagcgatg gctacctgtc gctgctgtac ggcgtcggcc tgtccacgcc ggtcggcgcg      1320
     ttcgccgccg acgtcaccca cgcacgtacg acgttcgacc actacggcaa ccacaccggt      1380
     gccagcgtgc gcttgagcta cagcaacatg atcggcgaga ccgggaccaa cctgaccctg      1440
     gccgcctacc gctattcgac cgaaggcttc tacagcctgc aggacgcgct gtatgggcgc      1500
     gattcggaca agcgcggcat cgatccgacc acccgcggcc gccagcgcag ccagttccag      1560
     gtgacgctga accagccgct gggccgtcgt ggcggcgcac tgtacgtgac cggttcggtg      1620
     cgtgacttct acgatcgccc gggcacctcc aagcagtacc aggtgggcta caacaacgcc      1680
     tggcgctcgg tgaactatgg tttctcggcg ctgcgtaccg aagaaggcct gctcggccgt      1740
     tccgataccc agtacctgct gtcgatgagc gtgccgctgg gccgtggtac ccacccggtg      1800
     tcgttcagcg ccgatgtcgg cgtgcgcgac cgcggtggct acgacaacag ccgcgtcggc      1860
     atcaccggtt ctgccggcgt cgacaacaac ttcagctatg gcgcggcgct gtccgattcc      1920
     cgcgagggtg gcaccaccgc agtcggcaac gccgagtacc gcagccgcta caccgcgttg      1980
     aatgccacct acagccactc gcgcgatttc cgccaggcct cggtcggcgc caacggcagc      2040
     gtggtcgtgc atcctggcgg cttcaccttc accccgcagc gtggcgatac catggtgctg      2100
     gtggaagcac cgggcgcacg cgatgcgatc gtcagcaacg cccccggcct gcgtgtcgat      2160
     ggccgcggct acgccgtggt cccgtacgtg tcgccgtacc gcctcaacac cgtcaccctc      2220
     gacccgcagg gcatggccca cgacgtcgaa ctggaaagca ccagccagtc ggtggcaccg      2280
     ttcgccggtg cgatcagcta cctgcgcttc gatacccgca agggcaacgc gctgctgatc      2340
     caggtccgca acaccgatgg ccgcacgctg ccgttcggcg cgcaggtcaa ggacgagcag      2400
     ggccagccgg tgggcatggt cagccagggt ggccgcctgt acgtgcgcag cgagaagaac      2460
     cagggccagt tgcaggtcga gtggggcgca ggtgccgacc agcgctgcac cattgattac      2520
     caggtaccgg cgggcgccga tgcgtccaag accggcttca tcccgctgga ggcagcatgc      2580
     cgatga                                                                 2586
//

If you have problems or comments...

PBIL Back to PBIL home page