(data stored in ACNUC7421 zone)

EMBL: CP001111.PE567

CP001111.PE567       Location/Qualifiers
FT   CDS_pept        674798..676945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0567"
FT                   /product="General secretory system II protein E domain
FT                   protein"
FT                   /note="PFAM: General secretory system II protein E domain
FT                   protein; KEGG: mms:mma_2623 bacteriophage N4 adsorption
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50272"
FT                   /db_xref="GOA:B4SJA4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA4"
FT                   /protein_id="ACF50272.1"
FT                   /translation="MDGLFWNIQLANYYAALEATAAAVAVLILISSLDDLFIDVWYWVR
FT                   ESWRALTIKRRDAYKPLTQEDLLQRPEQPLAIMVPAWMEYDVIAQMVENMINVLDYREY
FT                   VVFVGTYPNDQQTIDEVERMRRRYKRLRRVEVPHDGPTSKADCLNWLILAIFEYEKRHD
FT                   IEFAGVILHDSEDVLHPMELRFYNYLLPRKDMIQLPVTSLDREWYELVAGVYMDEFAEW
FT                   HAKDLVVRESVSGMVPSAGVGTCFSRRALLALSAQTDNQPFNTDSLTEDYDVGARLAAM
FT                   GMQSIFARFPVQFRVRRPSWFGWGPVRERTQQMALCVREYFPDNFRASYRQKARWVLGI
FT                   GLQSWESLGWRGSLATKYLLARDRKGIITSFVSIIAYVIFLQLLLFWLLKMTGVWTMQF
FT                   PSVFQPGTWQMNVALLTTAALATRVVQRFYFVNRLYGWEHALMSIPRMVVGNMINFMAT
FT                   ARAWKVFLAYLLFGKRMVWDKTMHDFPDAAQLVQTRKQLGELLGTWQAVEPERLQQALD
FT                   QQHAGRQQPLGRILLTQGWLDDETLAEAIAFQGDLPRAVIDVDYLRACQFPVSADACVQ
FT                   WRMLPLPPRQEGTLRLAVASPLPEEALALLKQETRSEHIEQSIARESEINAGLRLIGGD
FT                   RQWHLDNVPLLGDLLVEMRLIDHARFEIALDDYKPQRDGRIGDYLVKQGITTEEAVAQA
FT                   MQEQRRRAATLQSPPPGALPA"
     gtggacggtc tgttctggaa catccagctg gccaactact acgccgcact ggaagccacg        60
     gcggcggcgg tggccgtgct gatcctgatc tccagtctcg atgacctgtt catcgatgtc       120
     tggtactggg tccgcgaaag ctggcgcgcg ctcaccatca agcgtcgcga tgcctacaag       180
     ccgttgaccc aggaagacct gctgcagcga ccggagcagc cgctggcgat catggtgcca       240
     gcgtggatgg agtacgacgt catcgcgcag atggtcgaga acatgatcaa cgtactcgac       300
     taccgcgagt acgtcgtgtt cgtcggcacc tatcccaacg accagcagac cattgatgaa       360
     gtggagcgca tgcgccgccg ctacaagcgc ctgcgccgcg tggaagtgcc gcacgacggg       420
     ccgaccagca aggccgactg cctgaactgg ctgatcctgg ccatctttga gtacgagaag       480
     cgccacgaca tcgagttcgc cggtgtgatc ctgcacgaca gcgaggacgt gctgcatccg       540
     atggaactgc gcttctacaa ctacctgctg ccacgcaagg acatgatcca gctgccggtt       600
     acctcgctgg accgcgagtg gtacgagctg gtggccggcg tttacatgga cgagttcgcc       660
     gaatggcatg ccaaggatct ggtggtgcgc gagagcgtgt ccggcatggt gccctcggcg       720
     ggcgtcggta cctgcttctc gcgacgcgcg ctgctggcgt tgagtgcaca gaccgacaac       780
     cagcccttca acaccgacag cctcaccgaa gactacgacg tcggtgcacg actggcggcg       840
     atgggcatgc agtcgatctt cgcgcgcttc ccggtgcagt tccgcgtgcg ccggccctcg       900
     tggttcggct ggggcccggt gcgcgaacgc acccagcaga tggccctgtg cgtgcgcgag       960
     tacttccccg acaacttccg cgcttcctac cggcagaagg cacgctgggt gctgggcatc      1020
     ggcctgcaga gctgggagtc gctgggctgg cgcggctcgc tggccaccaa atacctgctg      1080
     gcgcgagacc gcaagggcat catcacctcg ttcgtcagca tcatcgccta cgtcatcttc      1140
     ctgcagctgc tgttgttctg gctgctgaaa atgaccgggg tatggacgat gcagtttccc      1200
     agcgtgttcc agcccggtac ctggcagatg aacgtggcgc tgctgaccac ggctgcactg      1260
     gcgacccgcg tcgtgcagcg cttctacttc gtcaaccggc tgtatggctg ggaacatgcg      1320
     ctgatgtcga tcccgcgcat ggtggtcggc aacatgatca atttcatggc caccgcgcgt      1380
     gcctggaagg tgttcctggc ctacctgctg ttcggcaagc gcatggtctg ggacaagacc      1440
     atgcacgatt tcccggatgc ggcgcagctg gtacagaccc gcaagcagct gggcgaactg      1500
     ctgggcacct ggcaggccgt tgaacccgaa cgcctgcagc aggcgctgga ccagcagcat      1560
     gccggccggc agcagccgtt gggccgcatc ctgcttaccc agggctggct ggacgatgaa      1620
     acactggccg aggcgatcgc cttccagggt gacctgccac gcgcggtgat cgacgtggat      1680
     tacctgcgtg cctgccagtt cccggtcagt gccgatgcct gcgtgcaatg gcggatgctg      1740
     ccgctgccgc cgcgtcagga aggtaccctg cggctggccg tggccagccc attgcccgaa      1800
     gaggcattgg cactgctgaa gcaggaaacc cgcagcgagc acattgaaca gagcatcgcc      1860
     cgcgaaagcg agatcaacgc gggactgcgc ctgatcggtg gcgaccggca gtggcacctg      1920
     gacaacgtgc cactgctggg cgacctgctg gtggaaatgc gcctgatcga tcacgcacgc      1980
     ttcgagatcg cactggacga ctacaagccg cagcgcgacg gccgcatcgg cgattacctg      2040
     gtgaagcagg gcatcaccac cgaggaggcc gtggcccagg ccatgcagga acagcgccgg      2100
     cgtgcggcca cgctgcagtc gccgcctccc ggagccttgc cggcatga                   2148
//

If you have problems or comments...

PBIL Back to PBIL home page