(data stored in ACNUC7421 zone)

EMBL: CP001111.PE568

CP001111.PE568       Location/Qualifiers
FT   CDS_pept        676942..679764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0568"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: dac:Daci_2942 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50273"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR025137"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA5"
FT                   /protein_id="ACF50273.1"
FT                   /translation="MKTTLLSTVIAIALATATAPVLAQADAPLPLSGAAYRIAEQAFAA
FT                   YERGDYPAAYQQSSEAIRLRPDVVRLRLLQIYALQKLGRGAEAQQRARRALDAGMKDPA
FT                   LPALAAAVPKTTTGAARSAALPRASATAADRNSRQAYLLATEAYAAYDAGQMGIAASKA
FT                   EQAFRQQPKQGAWALLWVAALEAQQQPEQADVAISTALQLGAPNVEELRARRVVLTRQR
FT                   ALLLAQQAYRSLSAGDDAAAIGHARDAVKLAPEVASYRLLLITAQLQGDQLADAEHSAD
FT                   QALQVDANDLNARVMRGYLRQRQGSTLRANEDFDAALATPGSTAQQRNVRLLAVDAALA
FT                   AGDRVRAAALLAPLQAPVPADEKDARAQLLLQQGIEQRAKAISSSRALPRISAEAYPAP
FT                   VQHCQSGDSSNVCELMPADLQGDGGAAQRAYAAYARRDYADAIGEARQAVQLAPEDVNL
FT                   QGLLTTALAAGNRVQQDEARQRLDAALAQHPDDAGALMQRGYLNQKAREPARALADFHA
FT                   AEATGKAPKSVVLDQAYASAANGDHPQAVTLLRSAIDRADAGELPLDEHQRYNVRNAIA
FT                   NYSREWGVIASAGFRGARQAATNVGGAAISTPGDSVFSTLEAFWRPPAFNDQHGTLELY
FT                   ARLLNTLYDEGGTYESIRAVDPCTGESTPDARARAERLSHSRSTTGWPSTIASFGMRYA
FT                   FGQTGLSAGIERRQFLGSATRQGEVYPASAAVQCRLQLALNPPLEASTLARYRLASGSG
FT                   GWMSYLTYGYYHGTDLRTDVNQWWMVSGYAQGGYTWDDNGASFTLDALDANGTPVRRVG
FT                   EANGRLHREQWFAAGELRAGRSFRFGSGQTHWVVTPYVVIGADWLDQRSRVRDLRYPLL
FT                   PSQSFALNDSQRSWSLGAGPGVGVRYWFREDHYNTPRSYLDLTVQYRFAIGGGDTQRAK
FT                   GLFATAILYY"
     atgaagacca cgctgctgtc caccgtcatt gctatcgcgc tggctacagc caccgcaccg        60
     gtactggcac aggccgatgc gccgctgcca ttgtccggtg cggcctaccg catcgccgag       120
     caggcgtttg ccgcctatga acgtggcgat taccccgcgg cctaccagca gtccagtgaa       180
     gcgatccggc tgcgcccgga tgtggtgcgg ctgcgcctgc tgcagatcta tgcgctgcag       240
     aagctcggtc gtggcgcaga agcgcagcag cgggcgcgcc gtgcgctgga cgcggggatg       300
     aaggatccgg ctttgccggc gctggccgcc gctgtgccca agacgaccac aggtgcggcg       360
     cgtagcgcag cgttgccacg tgcgtccgcc acggcggccg accgcaacag ccggcaggcc       420
     tacctgctgg caaccgaagc ctatgcggcc tacgacgccg ggcagatggg cattgccgcc       480
     agcaaggccg agcaggcgtt ccggcagcag ccgaagcagg gcgcgtgggc gctgctgtgg       540
     gtggcggcgc tggaggctca gcaacagccc gaacaggccg acgtcgccat cagcaccgcg       600
     ctgcagctgg gggcacccaa cgtcgaggaa ctgcgcgcgc gccgcgtggt gctgacgcgc       660
     caacgcgcgc tgctgctggc ccagcaagcc tatcgatcgc tgtccgcagg tgatgatgcc       720
     gcggccattg gacatgcgcg cgacgccgtg aagctggcac cggaggtggc ttcataccgg       780
     ttgctgctga tcaccgcgca gctgcagggc gatcagctgg ccgacgctga gcacagtgcc       840
     gatcaggcac tgcaggtgga tgccaacgac ctcaatgcac gggtcatgcg cggttacctg       900
     cgccagcgcc agggcagcac gttgcgggcc aatgaggatt tcgacgccgc gcttgccacg       960
     ccgggatcaa ccgcgcagca gcgcaacgtg cgcctgctcg cggtggatgc ggcactggct      1020
     gccggcgatc gggtgcgtgc ggctgcactg ctggcaccgt tgcaggcgcc agtgccagca      1080
     gatgaaaaag acgcacgggc acagctgctg ttgcagcagg gcatcgagca gcgcgccaag      1140
     gcgattagct ccagtcgcgc gcttccccgc atcagcgccg aggcctaccc ggcaccggtc      1200
     cagcactgcc agtccggtga cagcagcaac gtctgcgagc tgatgccggc cgaccttcag      1260
     ggggatggcg gtgccgcgca gcgtgcctac gctgcctatg cacgcaggga ctacgctgac      1320
     gccatcggtg aggcacggca ggccgtacaa ctcgcaccgg aggacgtgaa cctgcagggc      1380
     ctgctgacca ccgcgctggc agcgggcaac cgcgtccagc aggacgaagc gcggcagcgc      1440
     ctggatgcgg cactggcgca gcaccctgat gatgcgggcg cgctgatgca gcgcggctac      1500
     ctcaaccaga aggcacgcga accggcgcgc gcactggccg acttccatgc cgccgaggcc      1560
     accggcaagg caccgaaaag cgtagtcctc gaccaggcct acgccagcgc cgccaacggc      1620
     gatcatccac aggcggtgac gctgctgcgt agcgcgattg atcgcgccga tgccggtgag      1680
     ctgccgctgg atgagcacca gcgatacaac gtgcgcaatg ccatcgccaa ttattcgcgc      1740
     gagtggggcg tgatcgcctc ggcgggtttc cggggtgcgc gccaggccgc aaccaatgtc      1800
     ggcggtgcgg cgatcagtac gcccggcgat tcggtgttca gtacactgga ggcgttctgg      1860
     cggcccccgg ccttcaacga ccagcatggc acgctggagc tctacgcacg cctgctcaac      1920
     acgctgtacg acgagggtgg cacctacgag tcgatccgtg cggtggatcc gtgcaccggc      1980
     gaatcaacgc cggatgcgcg tgcacgcgcc gagcgcctca gtcattcgcg ttcgaccacg      2040
     ggttggccat ccaccatcgc ttccttcggc atgcgctatg cgttcggcca gaccgggctc      2100
     agtgccggta tcgagcgcag acagttcctc ggcagtgcca cccgccaggg cgaggtctac      2160
     cccgcatcgg cggccgtgca atgccgcctg cagctggcgc tgaacccacc actggaagcc      2220
     agtacgctgg cgcgctaccg gttggccagt ggttccggtg gatggatgtc ctacctgacc      2280
     tacggctact accacggcac cgatctgcgc accgatgtga accagtggtg gatggtcagt      2340
     ggctacgcgc aggggggata tacctgggac gacaacggtg ccagcttcac ccttgacgcg      2400
     ctcgatgcca acggcacacc ggtgcggcgc gtgggcgagg ccaatggccg tctgcatcgc      2460
     gaacagtggt tcgccgctgg tgaactacgt gccggccgca gtttccgctt cggttccggg      2520
     cagacccact gggtggtcac gccctatgtg gtgataggtg cggactggct ggaccagcgc      2580
     tcgcgcgtgc gcgacctccg ctacccgctg ttgccgtcgc agtcgttcgc gctcaacgac      2640
     agccagcgca gctggtcact cggcgcgggc ccgggcgtgg gcgtgcgcta ctggttccgc      2700
     gaggaccact acaacacgcc gcgctcctac ctggatctga ccgtgcagta ccgctttgcg      2760
     atcggcggcg gtgatacgca gcgcgccaag ggcctgttcg ccaccgccat cctctactac      2820
     tga                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page