(data stored in ACNUC7421 zone)

EMBL: CP001111.PE569

CP001111.PE569       Location/Qualifiers
FT   CDS_pept        complement(679758..680762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_2934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50274"
FT                   /db_xref="InterPro:IPR027849"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA6"
FT                   /protein_id="ACF50274.1"
FT                   /translation="MPPPVLPADPSSPLRRRLLRAAVLAPLAGTLATLPGCSLPVQVDG
FT                   SFLQPWRSHLQWGLADWQRSLKLARTLGCRQLVLQWTGIVGGSDGDWSLPDGSLQQLFT
FT                   AASENDIRIRVGLPFQQRWWQAIGADDATLQAFLAESLGHARSWLAQAPWAQQPAFGGW
FT                   YLPYELEQYHWADPARQHWLAQWLHGLVQAASARGGDCAMSCYFSRLQTDGNLVTLWQA
FT                   VLAQAAVRPMVQDGVGVAGAGNVQQLQPLLDHFHAHGIGFDAIVELFRELPGGPADGSG
FT                   FKGETADAARIQRQLAWARDSGAQHVLVYALEPWLTQDTPQAAALRRRWGLPQ"
     atgccaccgc cagtccttcc tgctgatccg tcctcgccgt tgcgccgccg gctgctgcgt        60
     gcggcagtac tggcgccgtt ggccggtacg ctcgccaccc tgcccggctg ctcgctgccg       120
     gtgcaggtgg atggctcctt cctgcagccc tggcgcagcc acctgcagtg gggcctggcc       180
     gactggcagc gatccttgaa gcttgcacgt acgctgggct gcaggcagct ggtgctgcaa       240
     tggaccggca tcgtcggtgg cagtgacggc gactggtcat tgcccgacgg cagcctgcag       300
     cagctgttca ccgctgccag cgagaacgac atccgcatcc gcgtcggcct gcccttccag       360
     caacgctggt ggcaggccat cggcgcagac gatgccacgc tgcaggcctt cctggccgag       420
     agcctggggc atgcacgcag ctggttggca caggcgccct gggcgcagca gccggccttc       480
     gggggctggt acctgcccta cgagctggag cagtaccact gggccgatcc ggcccgccag       540
     cactggctgg cgcagtggct gcacgggctg gtgcaggcgg ccagcgcacg cggtggtgac       600
     tgcgcgatgt cctgctactt cagccgcctg cagaccgatg gcaacctggt cacgctgtgg       660
     caggccgtgc tggcccaagc ggcggtgcgg ccgatggtgc aggacggtgt gggtgtagcc       720
     ggtgccggca acgtgcagca gctgcaaccg ctgctcgatc atttccatgc acatggcatt       780
     ggtttcgatg cgatcgttga actgttccgc gaactgcccg gcggccctgc cgacggcagc       840
     ggattcaagg gcgaaaccgc cgatgccgca cgcatccagc ggcagttggc atgggcacgc       900
     gacagcggcg cgcaacacgt gctggtctat gcactggagc cgtggctgac ccaggacacc       960
     ccgcaggccg cggcgctgcg acgacgttgg ggcctgcctc agtag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page