(data stored in ACNUC7421 zone)

EMBL: CP001111.PE570

CP001111.PE570       Location/Qualifiers
FT   CDS_pept        complement(680845..682161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0570"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: xcv:XCV0318 major facilitator
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50275"
FT                   /db_xref="GOA:B4SJA7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA7"
FT                   /protein_id="ACF50275.1"
FT                   /translation="MSLLERLFQLQQHGTTVRTELLAGVTTFLTMSYIVFVNPEILGTT
FT                   GMDAGAVFVATCLAAALGSAVMALAANFPVGMAPGMGLNAFFAFTVVGAAGLPWQQALG
FT                   AVFISGLVFLVLSLTGVRAWLVSGIPSSLRSAIVAGIGLFLAIIALQKSGVIVGNEDTL
FT                   VALGPLNTAPPLLALAGFLLIAVLEARRIRGAILIGILAVTGAGWALGDVQYQGLVSLP
FT                   PSLAPTFLQLDLPGLLHHDGGAPIAVLLQVVLVFVLVEVFDATGTLYGVVGRAGLLKLP
FT                   GAQKRFGRALLADSTAIVAGSMLGTSSTTAFAESASGVQVGGRTGLTALVVSALFLAAL
FT                   LFSPLAAMVPSYATAPALLFVAGLMLRELVEVDWSDLTESVPAALCALAMPFTYSIANG
FT                   LAFGFIAYAALKAGTGRWREVHPAVWLVAVLFTLRYALE"
     atgtcactgc tcgaacgcct gttccagctg cagcagcacg gcaccaccgt gcgcaccgag        60
     ctgctggccg gtgtcaccac cttcctgacg atgtcctaca tcgtcttcgt caatcccgag       120
     atcctcggca ccaccggcat ggacgccggc gcggtgttcg tggccacctg cctggccgct       180
     gcactgggtt cggcggtgat ggcgctggcc gccaatttcc cggtcggcat ggctccgggc       240
     atgggcctga acgcgttctt cgccttcacc gtggtcggtg ccgctggcct gccctggcag       300
     caggcactgg gtgcggtgtt catctccggc ctggtgttcc tggtgctgtc gctgactggc       360
     gtgcgggcgt ggctggtgtc gggcattcct tcgtcgctgc gctcggccat cgtggccggc       420
     atcggcctgt tcctggcgat cattgcgctg cagaaatccg gcgtgatcgt cggcaatgaa       480
     gacacgctgg tggcactggg cccgttgaac acggcaccgc cgctgttggc gctggccggc       540
     ttcctcctga tcgcggtgct ggaagcgcgc cgcatccgcg gtgcgatcct gatcggcatc       600
     ctggccgtga ccggcgctgg ctgggcattg ggcgacgtgc agtaccaggg cctggtgtcg       660
     ctgccgccga gcctggcacc caccttcctg cagctggacc tgccgggcct gctgcaccat       720
     gacggcggcg cgccgattgc ggtgctgctg caggtggtgc tggtgttcgt gctggtggaa       780
     gtgttcgatg ccaccggcac gctgtacggc gtggtcggcc gcgccggcct gctgaaactt       840
     ccgggtgcgc agaagcgctt cggccgtgcg ctgctggccg acagcacggc gatcgtggcc       900
     ggttcgatgc tcggcaccag cagcaccacc gcttttgccg aaagcgcctc gggcgtgcag       960
     gtcggtggcc gtaccggtct gaccgcgctg gtggtgtcgg cgctgttcct ggctgcgctg      1020
     ctgttctcgc cgctggcggc gatggtgccc agctatgcca ccgcaccggc gctgctgttc      1080
     gtggccgggc tgatgctgcg tgaactggtg gaagtggact ggagcgacct gaccgaatcg      1140
     gtgccggccg cgctgtgtgc gctggcgatg ccgttcacct attcgatcgc caatggcctg      1200
     gcgttcggct tcatcgccta tgccgcgctg aaggccggca ccggccgctg gcgcgaagtg      1260
     catccggcgg tgtggctggt ggcggtgctg tttaccctgc gctacgcatt ggagtaa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page