(data stored in ACNUC7421 zone)

EMBL: CP001111.PE571

CP001111.PE571       Location/Qualifiers
FT   CDS_pept        complement(682345..684009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0571"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: xom:XOO_3642 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50276"
FT                   /db_xref="GOA:B4SJA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:B4SJA8"
FT                   /protein_id="ACF50276.1"
FT                   /translation="MSSQYIYTMNRVSKVVPPKRQIIKDISLSFFPGAKIGLLGLNGAG
FT                   KSTVLKIMAGVDTDFEGEARPQAGIKVGYLAQEPELDPTKTVREAVEEGVGEVLQAQAA
FT                   LEAVYAAYAEEGADFDALAKEQERLEAILAAGDAHTLENQLDVAADALRLPPWEAIVGK
FT                   LSGGEKRRVALCRLLLQKPDMLLLDEPTNHLDAESVEWLEQFLARYTGTVVAVTHDRYF
FT                   LDNAAEWILELDRGRGIPWKGNYTDWLTQKDERLKQEDNQEKARQKAIQKELEWSRQNA
FT                   KGGRTKGKARLARLEELQSVDYQKRNETNEIFIPPGERLGNAVMEFKNVSKKFGDRLLF
FT                   DNLSFLVPGGAIVGIIGPNGAGKSTLFKMITGQEKPDTGEIVVGPTVQLSYVDQSRDAL
FT                   EGNHSVFQEIAGGLDILNINGIEIQSRAYIGRFNFKGQDQQKMVGSLSGGERGRLHMAK
FT                   TLLQGGNVLLLDEPSNDLDIETLRALEDALLEFPGNTFVISHDRWFLDRIATHILAFEG
FT                   DSHVEFFQGNYREYEEDKRRRMGDDAAPKRLRFKALK"
     atgtcctcgc aatacatcta caccatgaac cgcgtgtcca aggtggtccc gcccaagcgg        60
     cagatcatca aggacatctc gctgtcgttc ttcccgggcg cgaagatcgg cctgctgggc       120
     ctgaacggcg ccggcaagtc caccgtgctg aagatcatgg ccggcgtgga caccgatttc       180
     gagggcgaag cccgcccgca ggctggcatc aaggtcggct acctggcgca ggaaccggag       240
     ctggacccga ccaagaccgt gcgtgaagcg gtcgaggaag gcgtgggcga agtgctgcag       300
     gcgcaggctg cgctggaagc ggtgtacgcg gcctatgccg aagaaggtgc cgacttcgac       360
     gccctggcca aggaacagga gcgcctggag gcgatcctcg ccgcgggcga tgcgcacacc       420
     ctggaaaacc agctggacgt agccgccgat gcgctgcgcc tgccgccgtg ggaggccatc       480
     gtcggcaagc tgtccggtgg tgagaagcgc cgtgttgcgc tgtgccgcct gctgctgcag       540
     aagccggaca tgctgctgct cgacgaaccg accaaccacc tcgacgccga gtcggtggaa       600
     tggctggagc agttcctggc gcgttacacc ggaaccgtcg tggccgtcac ccatgatcgc       660
     tacttcctgg acaacgccgc cgagtggatc ctggaactgg accgcggtcg cggcattccg       720
     tggaagggca actacaccga ctggctgacc cagaaggatg agcgcctgaa gcaggaagac       780
     aaccaggaaa aggcccgcca gaaggcgatc cagaaggaac tggagtggtc gcgccagaac       840
     gccaagggcg gccgcaccaa gggcaaggcc cgtctggccc gcctggaaga gctgcagtcg       900
     gtcgattacc agaagcgcaa cgagaccaat gaaatcttca tcccgccggg cgagcgcctg       960
     ggcaacgcgg tgatggagtt caagaacgtc tccaagaagt tcggcgaccg cctgctgttc      1020
     gacaacctga gcttcctggt gccgggcggc gccatcgtcg gcatcatcgg ccccaacggt      1080
     gccggtaagt cgactctgtt caagatgatc accggtcagg aaaagccgga caccggcgag      1140
     atcgtggtcg gcccgaccgt gcagctgtcc tatgtcgacc agagccgtga tgcgctggaa      1200
     ggcaaccaca gcgtgttcca ggaaatcgct ggcggcctgg acatcctcaa catcaacggc      1260
     atcgagatcc agtcgcgcgc ctacatcggc cgcttcaact tcaagggcca ggaccagcag      1320
     aagatggtcg gttcgctgtc cggtggtgag cgtggccgcc tgcacatggc caagaccctg      1380
     ctgcagggtg gcaacgtgct gctgctcgac gaaccgtcca acgatctgga tatcgaaacc      1440
     ctgcgtgcgc tggaagatgc gctgctggag ttcccgggca acaccttcgt catctcgcat      1500
     gatcgctggt tcctggatcg catcgcgacc cacatcctgg cgttcgaagg cgactcgcac      1560
     gtggagttct tccagggcaa ctaccgcgag tacgaagaag acaagcgccg ccgcatgggc      1620
     gacgacgcgg cgccgaagcg cctgcgcttc aaggcgctga agtaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page