(data stored in ACNUC7421 zone)

EMBL: CP001111.PE573

CP001111.PE573       Location/Qualifiers
FT   CDS_pept        684926..686179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0573"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   xcb:XC_3544 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACF50278"
FT                   /db_xref="GOA:B4SJB0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SJB0"
FT                   /protein_id="ACF50278.1"
FT                   /translation="MFPRDVRIESYDPELAKAIAAETQRQEDHVELIASENYTSPAVME
FT                   AQGSQLTNKYAEGYPGKRYYGGCEYVDIAEQLAIDRLKQLFGADYANVQPHSGSQANQA
FT                   VYFALLQPGDTILGMSLAHGGHLTHGAKVNASGKLFNAVQYGVNDQGLIDYDEVERLAL
FT                   EHKPKMVVAGFSAYSQVIDWARFRAIADKVGAYLFVDMAHVAGLVAAGVYPSPLEHAHV
FT                   VTSTTHKTLRGPRGGIIVAKGAGEDLVKKLQSIVFPGIQGGPLMHVIAGKAVAFKEALE
FT                   PGFKAYQQQVVKNAQAMANTLIARGYKIVSGGTQNHLMLVDMIGKDVSGKDAEAALGKA
FT                   HITVNKNSVPNDPRSPFVTSGLRLGTPAVTTRGYVEQDCVDLANWIADVLDAPSDDAVI
FT                   ARVRDAVSAQCRKYPVYG"
     atgttcccgc gtgacgtccg catcgaatcc tacgatcccg aactggccaa ggccatcgcc        60
     gctgagaccc agcgccagga agaccacgtc gagctgatcg ccagcgagaa ctacaccagc       120
     ccggcggtga tggaagccca gggcagccag ctgaccaaca agtacgccga aggctacccg       180
     ggcaagcgct actacggtgg ctgcgaatac gtggacatcg ccgagcagct ggcgatcgac       240
     cgtctgaagc agctgttcgg cgccgactac gccaacgtgc agccgcacag tggttcgcag       300
     gccaaccagg ccgtgtactt cgccctgctg cagccgggtg acaccatcct cggcatgagc       360
     ctggcccacg gcggccacct cacccacggt gccaaggtga acgcctcggg caagctgttc       420
     aacgccgtgc agtacggcgt gaacgaccag ggcctgatcg actacgacga agtcgagcgc       480
     ctggccctgg agcacaagcc gaagatggtc gtggccggct tctcggccta ctcgcaggtg       540
     atcgactggg cgcgcttccg cgccatcgcc gacaaggtcg gtgcctacct gttcgtcgac       600
     atggcacacg tcgccggcct ggttgctgct ggcgtctacc cgagcccgct ggaacatgcg       660
     cacgtggtca cctcgaccac ccacaagacc ctgcgcggcc cgcgcggcgg catcatcgtc       720
     gccaagggcg ccggcgaaga cctggtcaag aagctgcagt cgatcgtgtt cccgggcatc       780
     cagggtggtc cgctgatgca cgtcatcgcc ggcaaggccg tggccttcaa ggaagcgctg       840
     gaaccgggct tcaaggccta ccagcagcag gtggtgaaga acgcccaggc gatggccaac       900
     acgctcattg cgcgcggcta caagatcgtc tccggtggca cccagaacca cctgatgctg       960
     gtcgacatga tcggcaagga cgtgtccggc aaggacgcgg aagccgcgct gggcaaggcc      1020
     cacatcaccg tcaacaagaa ctcggtgccg aacgacccgc gttcgccgtt cgtcacttcg      1080
     ggcctgcgcc tgggcacccc ggcggtgacc acccgtggct acgtcgaaca ggactgcgtg      1140
     gacctggcca actggatcgc cgacgtgctc gacgcgccga gcgatgacgc cgtcatcgcc      1200
     cgcgtgcgcg acgccgtcag cgcgcagtgc cgcaagtacc cggtctacgg ttga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page