(data stored in ACNUC7421 zone)

EMBL: CP001111.PE58

CP001111.PE58        Location/Qualifiers
FT   CDS_pept        67117..68013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0058"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: xcv:XCV4328
FT                   putative PP-loop family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49763"
FT                   /db_xref="GOA:B4SRP3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4SRP3"
FT                   /protein_id="ACF49763.1"
FT                   /translation="MTAVISLPDPPQRASRGPRVAGPGQDRLGKRLRRQVGQAIADFGM
FT                   IEAGDKVMVCLSGGKDSYTLLDLLLQLQKRAPVPFELVAVNLDQKQPGFPEHVLPEYLA
FT                   ALGVPYQIIEQDTYSVVSRVIPEGRTMCSLCSRLRRGALYNHAKAHGFTRIALGHHCDD
FT                   MVATLFMNLFHHAKLAAMPPKLLSDDGQHVVIRPLAYVREHDIAEYAQARRFPIIPCTL
FT                   CGSQESLQRRQVGLMLKQWDQDHPGRIEQIARAMADVRPAQLADATLFDFRALGHSGHA
FT                   AHADAWLADAVPETPAD"
     atgaccgccg tgatttccct gcccgatccc ccgcagcgcg cttcgcgtgg cccgcgcgtg        60
     gccgggcccg ggcaggacag gctgggcaag cggctgcgtc gccaggtcgg ccaggccatc       120
     gccgacttcg gcatgatcga agcgggcgac aaggtcatgg tctgcctgtc cggtggcaag       180
     gacagctaca ccctgctgga cctgctgctg cagctgcaga agagggcgcc ggtgccgttc       240
     gaactggtcg cggtgaacct tgaccagaag cagcccggct tccccgagca tgtcctgccg       300
     gagtacctgg ccgcgctggg cgtgccgtac cagatcatcg agcaggacac ctactcggtg       360
     gtcagccggg tcattccgga aggccggacg atgtgttcgc tgtgctcgcg cctgcgccgc       420
     ggcgcgctgt acaaccacgc caaggcgcac ggtttcaccc ggatcgcgct gggccatcat       480
     tgcgacgaca tggtggctac gttgttcatg aacctgttcc accatgccaa gctggcggcc       540
     atgccaccga agctgctcag cgacgatggc cagcacgtgg tgatccgccc gttggcctac       600
     gtgcgcgagc acgacatcgc cgagtatgcg caggcccgcc gtttcccgat cattccctgc       660
     accctgtgtg gcagccagga aagcctgcag cgtcggcagg tcggcctgat gctcaagcag       720
     tgggaccagg accatccggg ccgtatcgaa cagatcgcac gcgccatggc cgatgtacgg       780
     ccagcacaac tggccgatgc caccctgttc gatttcaggg ccctgggcca cagcgggcat       840
     gccgcgcatg ccgatgcctg gctggccgac gcagtccccg agacgcctgc cgactaa          897
//

If you have problems or comments...

PBIL Back to PBIL home page