(data stored in ACNUC7421 zone)

EMBL: CP001111.PE62

CP001111.PE62        Location/Qualifiers
FT   CDS_pept        71106..73529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0062"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; KEGG: reu:Reut_B4471
FT                   PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49767"
FT                   /db_xref="GOA:B4SRP7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP7"
FT                   /protein_id="ACF49767.1"
FT                   /translation="MRTSTVNAAGLPAAVAVMACLMLPATASAAGCETPLRIAWPSDRA
FT                   PLSSAIEGQAEGVSAAYLNLLGEQRPLQAQPLPATAVVEGLLPPATQALLGWPRSQLPS
FT                   GWVASAPYLQLPQVIVRRADARPVLGLEDLRERAVASPDRLPLAALLAEQAPGAQLLPP
FT                   APLDDALSLLGTGLVDAVIANLGEVEAGLRRYQGDRLVIAAPAGFDDALVLATVPACAG
FT                   VIPGFEQAVSQLTDTQRDVIRTGWLPDQPRNPPSSSPLRWLVPASLILLALALVYAFGY
FT                   WRVHRESARRRVAAQRLQEVTANLPAVVYQARRTATGDYSFPQIAGDVQALFGVSVETA
FT                   RIDHPRLLAAVHPDDRTLVMDCVEAAALARGPIDVTFRTRSPQGWRWVHSQGRTLACDD
FT                   SNVEWSGYWMDVSEVHTRTQALADARREAEQAALAKTHFLATMSHEIRTPMSTLLGMLE
FT                   RLAASDLDHRQQQVLATIGDAAQMLRQILDDVLHSQRLQPAPLQRQPTDLAALLRAVQQ
FT                   LLLPVAASRGLYLQIHLDPALQAGSLADSLRLRQILFNLVGNALKFTLHGGVELRVQVL
FT                   QQHAQGQRLRLQVSDSGVGISAERQQAVFGAYTQAEASTTRRFGGSGLGLAICRELAVS
FT                   MGGDLQLHSATGEGTTVWLELDLSACELPAGAPSPAIAEEQPLPPARVLVAEDHPTNLQ
FT                   LLEQRLHDLGLQVHACADGAQALQAWQSQPFELVITDCHMPGMNGFALARAIRADTCQH
FT                   RARVPIIALTASVLERTREACRDAGIDHFLAKPVEPRELRALLAVLLAPDSVRQ"
     atgaggacgt ccaccgtgaa tgccgccggc ctccctgcag ctgttgctgt catggcctgc        60
     ctgatgctgc ccgcaaccgc gtccgccgct ggctgcgaga caccgctgcg cattgcctgg       120
     ccttccgatc gggcgccatt gtcgtccgcg atcgaggggc aggccgaagg ggtcagcgcg       180
     gcctacctga acctgctggg cgaacaacgg ccgctgcagg cgcaaccgct gccggccacg       240
     gcggtcgtcg aaggcctgtt gccgcccgcc acccaggcgt tgctgggctg gccgcgctcg       300
     cagctgcctt ccggctgggt ggccagtgca ccgtacctgc agctgccgca ggtgatcgtg       360
     cgccgcgccg atgcgcggcc ggtgctgggc ctggaagacc tgcgcgagcg cgcggtggcc       420
     agtcccgacc ggctgccgtt ggccgcgctg ctggccgagc aggctccggg tgcacagctg       480
     ctgccgccgg cgccgttgga tgatgcgctg tcgctgctgg gcaccggtct ggtcgacgcg       540
     gtgatcgcca acctcggcga ggtcgaggcc gggctgcgcc ggtaccaggg cgatcggctg       600
     gtgattgccg cgccagccgg gttcgacgat gcgcttgtgc tggccaccgt accggcctgt       660
     gccggcgtca ttcccggctt cgagcaggcc gtgtcgcagc tgaccgacac gcagcgcgac       720
     gtgatccgca cgggatggct gccggaccag ccacgcaacc cgccgtcctc atcgcccctg       780
     cgttggctgg taccggcctc gctgatcctg ctggcgctgg cgctggtcta cgccttcggc       840
     tattggcgcg tgcaccgcga aagcgcaagg cgtcgcgtgg ccgcgcagcg cctgcaggaa       900
     gtgaccgcga acctgccggc ggtggtctac caggcgcgcc gcaccgctac cggggactac       960
     agctttccgc agattgccgg cgatgtgcag gcgctgttcg gggtgagcgt ggagaccgcg      1020
     cggatcgacc acccgcggct gctggccgcg gtccatcccg atgaccggac tctggtgatg      1080
     gactgtgtcg aagcggccgc attggcccgt ggaccgatcg acgtcacctt ccgtacgcgc      1140
     tcgccacagg gctggcgctg ggtgcattcg cagggccgca cgctggcgtg cgatgacagc      1200
     aacgttgagt ggagcggcta ctggatggat gtcagcgagg tacacacacg tacccaggcg      1260
     cttgcagatg caaggcgcga ggccgagcag gccgcgctgg ccaagaccca cttcctggcg      1320
     acgatgagtc acgagatccg cacgccgatg agcacgctgc tgggcatgct cgaacgattg      1380
     gccgccagcg atctggacca ccgccagcaa caggtgctgg ccaccatcgg cgacgccgcg      1440
     cagatgctgc ggcagatcct tgacgatgtg ctgcacagcc agcgcctgca gcctgcgcca      1500
     ctgcagcggc agcctaccga cctggccgcg ctgctgcggg cagtgcagca gctgctgctg      1560
     ccggtggctg ccagccgtgg cctgtacctg cagatccatc tcgatcctgc actgcaggcc      1620
     gggtcgctgg ccgacagcct gcggctgcgc cagatcctgt tcaacctggt cggcaatgcg      1680
     ctcaagttca ccctgcatgg cggggtggaa ctacgggtgc aggtgctgca gcagcacgca      1740
     caggggcagc ggttgcgcct gcaggtaagc gatagcggtg tgggcatcag tgcggaacgg      1800
     cagcaggcgg tgtttggcgc ctacacccag gccgaggctt cgaccacgcg ccgcttcggc      1860
     ggcagtggac tgggcctggc aatctgccgt gagctggccg tgtcgatggg gggagacctg      1920
     cagctgcaca gtgcgaccgg cgagggcacc acggtatggc tggagctgga cctgagtgcc      1980
     tgcgagttgc ctgctggcgc gccgtcacct gcgatcgccg aggaacagcc actgccaccg      2040
     gcacgggtgc tggtggccga agaccatccc accaacctgc agctgttgga gcagcgcctg      2100
     cacgacctgg ggctgcaggt gcatgcctgc gccgatggag cgcaggccct gcaggcctgg      2160
     cagtcgcagc catttgaact ggtgatcacc gactgccaca tgccgggcat gaatggcttc      2220
     gcgctggcac gggcgatccg tgcagacacc tgccagcacc gcgcgcgggt accgatcatc      2280
     gcgctcaccg ccagcgtgct ggaacgcacc cgcgaggctt gccgcgacgc cggcatcgat      2340
     cacttcctgg ccaagccggt ggagccgcgc gaactgcgtg cattgctggc ggtgctgctg      2400
     gcgccggatt cagtgcgcca gtag                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page