(data stored in ACNUC7421 zone)

EMBL: CP001111.PE63

CP001111.PE63        Location/Qualifiers
FT   CDS_pept        complement(73515..74960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0063"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: xcv:XCV0036 glutamate synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49768"
FT                   /db_xref="GOA:B4SRP8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRP8"
FT                   /protein_id="ACF49768.1"
FT                   /translation="MSRKHAFQFLDLPRTMPQRIPVELRTSGDWGELYGKFGKEDAQYQ
FT                   AGRCLDCGNPYCSWKCPVHNAIPQWLQLVQENRIHEAATLCHSTNPLPEVCGRVCPQDR
FT                   LCEGSCTLEEFGAVTIGAVEKYIVDTALATGWRPDMAAVQATGHTVAVIGAGPAGLACA
FT                   DRLAHAGITAVVYDRYEQVGGLLQFGIPSFKLDKDVIRRRREVLEGMGVQFRLGVEVGR
FT                   DVSLQQLLDTHDAVFLGTGAYRYTDGGLDGQDLKGVLPALPFLVQNSRIVGGDDPHGRP
FT                   IAGWEDTIALPDLNGKRVVVLGGGDTGMDCVRSAVRLGAAKVTCAYRRDEANMPGSARE
FT                   VANAREEGVRFLFNRQPLSIEAGADDEVIGVTVVETRLGEPDANGRQNAVPIEGSESLL
FT                   EADVVIIAFGFSPTVPAWLAEHGVEGQTNGRIVAGGKDRLPFQTAHPRLFAGGDAVRGA
FT                   DLVVTAVAEGRDAAASIVRLLAH"
     atgagccgca agcacgcctt ccagttcctc gacctgcccc gcaccatgcc gcagcgcatc        60
     ccggtcgaac tgcgcacctc cggcgactgg ggtgagctgt acggcaagtt cggcaaggaa       120
     gacgcccagt accaggccgg ccgctgcctg gattgcggca acccctactg cagctggaag       180
     tgcccggtgc acaacgccat tccgcagtgg ctgcagctgg tgcaggaaaa ccgcatccat       240
     gaagcggcca ccctgtgcca cagcaccaac ccgttgccgg aagtgtgcgg ccgggtctgc       300
     ccgcaggacc ggctgtgcga aggcagctgc acgctggagg agttcggcgc agtgaccatc       360
     ggcgcggtag agaagtacat cgtcgatacc gcgctggcca ccggctggcg gccggacatg       420
     gccgccgtgc aggccaccgg ccacacggtg gcggtgatcg gtgccggccc ggccggcctg       480
     gcctgtgccg accgcctcgc gcatgccggc atcactgccg tggtctacga ccgctacgag       540
     caggttggtg gcctgctgca gtttggcatt cccagcttca agctggacaa ggacgtgatc       600
     cgtcgccgcc gcgaggtgct cgaaggcatg ggcgtgcagt tccgcctggg cgtggaggtc       660
     ggccgtgacg tcagcctgca gcagttgctg gacacgcatg acgcggtgtt cctgggcacc       720
     ggcgcctacc gctacaccga tggcggcctc gacggccagg acctgaaggg cgtgctgccg       780
     gcgttgccgt tcctggtgca gaacagccgc atcgtcggtg gcgatgatcc gcacggccgg       840
     ccgattgccg gctgggaaga caccatcgcc ctgcccgacc tcaacggcaa gcgcgtggtg       900
     gtgctcggcg gcggcgacac cggcatggac tgcgtgcgca gcgcggtgcg cctgggcgcg       960
     gccaaggtga cctgcgccta ccgccgcgac gaggcgaaca tgcccggcag cgcgcgcgaa      1020
     gtggccaacg cgcgcgagga gggcgtgcgt ttcctgttca accgccagcc gctgtcgatt      1080
     gaagccggtg ccgatgacga agtgatcggc gtgaccgtgg tcgagacccg cctcggcgag      1140
     cccgatgcca atggccgcca gaacgcggtg ccgatcgagg gcagcgaatc gctcctggaa      1200
     gcggacgtgg tgatcatcgc gttcggtttc tcgcccaccg ttccggcgtg gctggccgag      1260
     cacggcgtgg agggccagac caacggccgc atcgtggctg gtggcaagga cagactgccg      1320
     ttccagaccg cgcatccgcg cctgttcgcc ggcggtgatg cggtacgtgg ggccgacctg      1380
     gtggtgaccg ccgtggctga aggccgcgac gccgccgcca gtatcgtccg gctactggcg      1440
     cactga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page