(data stored in ACNUC7421 zone)

EMBL: CP001111.PE65

CP001111.PE65        Location/Qualifiers
FT   CDS_pept        complement(79676..80065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49770"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ0"
FT                   /protein_id="ACF49770.1"
FT                   /translation="MSFPIRARSLSALLLPAVLALTACQAPALDEQDSATAHAQQAAEA
FT                   AKAPADDAGKATEAPPVGTCDASQVQSLVGQAYTDALGKQAQEDAGASQVRVLKPNDVA
FT                   TMEFLGDRLNIEVDDKGAVSGARCG"
     atgtcgtttc cgattcgcgc ccgttcgctc tccgccctgt tgctgccggc cgtgctggcc        60
     ctgaccgcct gccaggcacc ggcgctggac gaacaggatt cggccaccgc ccatgcccag       120
     caggccgcag aagccgccaa ggcaccggcc gacgacgccg gcaaggccac cgaggccccg       180
     ccggtcggca cctgcgacgc cagccaggtg cagagcctgg tcggccaggc ctacaccgac       240
     gcgctcggca agcaggcgca ggaagacgcc ggcgccagcc aggtgcgcgt gctcaagccc       300
     aacgacgtgg ccacgatgga gttcctcggc gaccgcctga acatcgaagt ggacgacaag       360
     ggcgcagtca gcggcgcgcg ctgcggctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page