(data stored in ACNUC7421 zone)

EMBL: CP001111.PE70

CP001111.PE70        Location/Qualifiers
FT   CDS_pept        84390..85193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC1162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49775"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ5"
FT                   /protein_id="ACF49775.1"
FT                   /translation="MMARPHLTPALSLMLLLACSACAPAGEHIAAAAPTSKPSTMPAQP
FT                   LSPDRGLPGLPEASGSAHPGGRYGALPEPARRVLTQLKCDVDGASDVQVFSLPGQGDQQ
FT                   DFMVTDRSGPGFQYWIRSFAGSAGTTGYLVQLENCPATTAGMRAYIAQGAAPLQDVTAS
FT                   LLAQAELPDAATMTAYQDKGAGDLFAFIGALDKVPVLRWVAEADPEQPLAVDARSFDHG
FT                   NAIHGGFLRWNQDHFEVARTVPAALWPCDDSPLLPCKGDPFVSGR"
     atgatggccc gcccgcacct gacacccgcc ctgtcgttga tgctgctgct ggcatgcagc        60
     gcctgtgcgc ccgccgggga acatattgcg gccgcagcgc cgacgtcgaa accgtcgacc       120
     atgccagcgc agcccttgtc gcctgatcgt ggattgcccg ggttgccgga agcctctggc       180
     agcgcccatc ccggcggccg ctacggtgcg ctgccggaac cggcgaggcg ggtgctgacg       240
     caactgaagt gcgacgtgga cggcgccagc gacgtgcagg tgttctccct tcccggacag       300
     ggcgaccagc aggatttcat ggtcaccgac cgcagtgggc ctggcttcca atactggatc       360
     cgttcctttg ccggcagcgc tggcaccaca ggctatctgg tacagcttga gaattgcccg       420
     gcaaccaccg caggcatgcg cgcctacatc gcacagggag ccgcaccgct gcaggatgtc       480
     accgcgtcgt tgctggcgca ggccgagctg cccgacgcgg cgaccatgac ggcttaccag       540
     gacaagggcg cgggtgatct gttcgccttc atcggggcgc tggacaaggt gccggtgctg       600
     cgctgggtgg ccgaagcaga ccccgaacag ccactggccg tcgatgcgcg cagcttcgac       660
     catggcaatg ccatccacgg cggtttcctg cgctggaacc aggatcactt cgaagtggcc       720
     aggaccgtac ccgccgcgct atggccctgc gatgacagcc cgttgctgcc gtgcaagggc       780
     gacccgttcg tgagcgggcg ttga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page