(data stored in ACNUC7421 zone)

EMBL: CP001111.PE73

CP001111.PE73        Location/Qualifiers
FT   CDS_pept        87475..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49778"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ8"
FT                   /protein_id="ACF49778.1"
FT                   /translation="MGLVINEAVVLRAVFHGAVDAHQIRYWLDRVQALIDAHRPFYFVA
FT                   STAPGATFCDDYRALQAVWYKQYKAAFRRYCRGLVRIASDAADQQRLDTPALHAAWAVP
FT                   YFVTADAGAGMRWIGEHLEQADAH"
     atgggtctgg tgatcaacga ggcggtggtg ctgcgtgccg tcttccatgg cgcggtggat        60
     gcgcaccaga tccggtactg gctggaccgc gtgcaggcgc tgatcgatgc ccaccgtccc       120
     ttctacttcg ttgccagcac cgcgcccggt gccaccttct gcgacgatta ccgtgccctg       180
     caggcggtct ggtacaagca gtacaaggcc gccttccggc ggtactgccg gggcctggtg       240
     cgcatcgcca gcgatgccgc cgatcagcag cggctggaca ctccggcgct gcatgcggcc       300
     tgggccgtgc cgtacttcgt caccgccgat gccggcgcgg gcatgcgctg gattggcgag       360
     cacctggagc aggccgatgc gcactga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page