(data stored in ACNUC7421 zone)

EMBL: CP001111.PE74

CP001111.PE74        Location/Qualifiers
FT   CDS_pept        87851..89071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0074"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fph:Fphi_0920 putative transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49779"
FT                   /db_xref="GOA:B4SRQ9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRQ9"
FT                   /protein_id="ACF49779.1"
FT                   /translation="MRTERAAASPFGLGVIVALYMAHALPLYFYNVAVPAILRSQGVDL
FT                   RWIGMLSLLYLPWALKFLWAPLVDRWHLPALGRRRSWLWLTQLLLLAGILVLAFTGLDH
FT                   GLVVFVLVGMWISSIAATQDIAIDGYTVEALAPAEHRLGSMAQSVGVALGSMIGGAGVL
FT                   WLYETRGWSVALLSLAAMSALTLLAVQRINETPARPDAPRPSILRALRRRELRWALLLI
FT                   VLYRLVEAPAMAMINPLLVDQQFSLTEIGLLISVGGAGTGMLAAVGAAWLLKQRRAEQL
FT                   LMHAGWWRTVLYVLLALMLYSGAMASSRWGLGVLVIALLALRYVAMTSLYALFMRVSSR
FT                   AQAGTDFTLLVCFELLVNFIGGALSGFLAKGLGYPIYYIALAAVSALGLLLCRPLMRRF
FT                   AAPTNSP"
     atgcgcactg agcgcgccgc cgcttcgccg ttcggcctgg gtgtgatcgt cgcgctgtac        60
     atggcgcatg ccttgcccct gtatttctac aacgtggcgg taccggccat cctgcgtagc       120
     cagggcgtgg atctgcgctg gatcggcatg ttgtcgctgc tttacctgcc gtgggcgctg       180
     aagttcctgt gggcaccact ggtggaccgc tggcatctgc cggccctcgg tcgccgccgc       240
     agctggctgt ggctgaccca gctgttgctg ctggccggga tcctggtgct ggcgttcacc       300
     ggcctggatc atggcctggt cgtgttcgtg ctggtcggca tgtggatctc gagcattgcc       360
     gccacccagg acatcgccat cgacggctac accgtggagg cgctggcgcc ggccgagcac       420
     cggttgggca gcatggcgca aagcgtgggt gtggccctgg gcagcatgat cggtggcgcc       480
     ggtgtgctgt ggctgtatga aacccgcggc tggagcgtgg ccctgctgag cctggccgca       540
     atgagcgcac tgaccctgct ggcagtgcag cggatcaacg aaacgccggc caggcccgac       600
     gcgccgcggc cgagcatcct gcgtgcgctg cgtcgtcgcg aactgcgctg ggcgctgctg       660
     ctgatcgtgc tgtaccggct ggtggaagcg ccggccatgg cgatgatcaa cccgctgctg       720
     gtcgaccagc agttcagcct gaccgagatc gggttgctga tctcggtggg cggcgccggt       780
     accggcatgc tggctgcggt gggcgccgcc tggctgctca agcagcgccg ggccgagcag       840
     ttgctgatgc acgctggctg gtggcgcacc gtgttgtatg tactgctggc gttgatgctt       900
     tacagcggtg cgatggcgtc gtcacggtgg ggcctgggcg tgctggtgat cgcgctgctg       960
     gcgctgcgct atgtggcgat gaccagcctg tatgccctgt tcatgcgggt cagttcgcgt      1020
     gcccaggccg gcactgactt caccttgctg gtgtgcttcg agctgctggt caatttcatc      1080
     ggcggtgcat tgtccggctt cctcgccaag ggactgggct accccatcta ctacatcgcg      1140
     ctggcggcag tttcggcgct cgggttgctg ctgtgccggc cgctgatgcg ccgcttcgca      1200
     gcacccacga actccccctg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page