(data stored in ACNUC7421 zone)

EMBL: CP001111.PE77

CP001111.PE77        Location/Qualifiers
FT   CDS_pept        91842..93836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0077"
FT                   /product="peptidase M56 BlaR1"
FT                   /note="PFAM: peptidase M56 BlaR1; KEGG: xcv:XCV0046 BlaR1
FT                   peptidase M56 family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49782"
FT                   /db_xref="GOA:B4SRR2"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR2"
FT                   /protein_id="ACF49782.1"
FT                   /translation="MDTTMLILLLERLGWTSLQTVLLVALVYGVCRALPSLSAATRCRL
FT                   WWLVSLQAVLGLFWSQPLQLAWLPAPQAVAMTATDVAADMVYPLAPDASAQLLATMPVP
FT                   AADVPAVAWWAVALAVLWASGVLLMALRTFGEWRRCRALLAAAYPCEDEALVQALQLAS
FT                   DAHGVRPAPRLWMSAQVDAPQLVGPFRPVLLLPAGDNALQGDALDLALTHELQHLQRRD
FT                   LQWGLLPALAQHLFFFHPLLRLSVREYAQAREEAVDAAVVGQHGASRQAYGRLLLQLGV
FT                   APQPHLGVASAAPNTTSLKRRLLSLQSRRSCPRILAMALTAVVVVVGVAPMRLVAAPVP
FT                   PAPPAPPAAPKAVVPPPPKAPNAPPAPPSAARVPAVPVAPAPPAEPADVEALSGPDDAD
FT                   VAVDVDVDVDTDMHSEHSTSHTTSITTYGRLDLGKSPSQAYVLVDGDSTFANGGIDDVT
FT                   VARRQLGKGPALWFRQGDKRYVVRDPMLIQTLQRAYSGAADLGRQQSELGRQQSALGRE
FT                   QGELGRQMGEMGRLQGEESRRIALAAAEVARSAMAAHDINREAAAEAAKAARGATSDMA
FT                   VAREAAREAAAEARRAMQEARSEAAQSGRTRDMQRLASQQSELASRQAALGSQQAALGE
FT                   RQARVHAQASQQAQQVIARALASGKAERL"
     atggacacca cgatgctgat cctgttgttg gaacggctgg gctggaccag cctgcagacc        60
     gtgctgctgg tggccctggt gtacggcgtg tgccgcgcac tgccgtccct gtcggcggcc       120
     acccgctgcc gcctgtggtg gctggtttcg ctgcaggccg tgctcggcct gttctggagc       180
     cagccgctgc agctggcctg gctgccggca ccgcaggcgg tggcgatgac cgccacggac       240
     gttgccgcag atatggtcta cccgctggcg ccggacgcct cggcgcagct gctggcgacg       300
     atgccggtgc ctgcagcgga cgtgccggca gttgcgtggt gggccgttgc actggctgtg       360
     ctgtgggcat ccggtgtgct gctgatggcc ctacgcacct tcggtgagtg gcgccgctgc       420
     cgggcgctgc tggccgccgc ctatccctgc gaggacgagg cgctggtgca ggcgctgcag       480
     ctggcctccg atgcccacgg cgtacgccct gcgccgcggc tgtggatgag cgcgcaggtg       540
     gacgcaccgc agctggtcgg cccgttccgc ccggtgctgc tgctgccggc cggcgacaat       600
     gccctgcagg gcgatgcgct ggacctggca ctgacccacg agctgcagca tctgcagcgg       660
     cgcgatctgc agtggggcct gctgcccgca ttggcccagc acctgttctt cttccacccg       720
     ctgctgcgct tgtcggtgcg cgaatacgca caggcccgcg aggaagccgt ggatgcggcc       780
     gtggtcggcc agcacggcgc gagtcgccag gcctatggcc gcctgctgtt gcagctgggc       840
     gtggcaccgc agccacacct gggcgtggcc agcgccgcgc cgaacaccac cagcctcaag       900
     cgccgcctgc tttcgctgca gtcgcgccgg tcctgcccgc gcatcctggc gatggcgttg       960
     accgctgtcg tcgttgtggt gggcgtggca ccgatgcggc tggtggcggc gccagtgccg      1020
     ccggcaccgc cggcgcctcc ggccgcaccg aaggccgtgg tgccgccgcc cccgaaggct      1080
     ccgaacgcgc cgcccgcacc gccttcggcc gcgcgcgttc cggccgtgcc ggtggcgccc      1140
     gcgccgcctg ccgagccggc cgatgtcgag gcgctgtcag gcccggacga tgccgatgtg      1200
     gcggtcgacg tggatgtcga tgtggatacc gacatgcaca gtgaacattc gacttcccac      1260
     accacctcca tcaccaccta cgggcgcctg gacctcggca agtcgccgtc gcaggcctac      1320
     gtgctggtcg atggtgattc gaccttcgcc aatggcggca tcgacgatgt aacggtggcg      1380
     cgcaggcagc tcggcaaggg gccggcgctg tggttccgcc agggcgacaa gcgctatgtg      1440
     gtgcgcgacc cgatgctgat ccagaccctg cagcgcgcct acagcggcgc cgcagacctc      1500
     ggtcgccagc agagcgaact gggccgccag cagagtgcgc tgggtcgcga gcagggcgaa      1560
     ctcggcaggc agatgggtga gatgggccgc ctgcagggcg aggagtcacg ccgcattgcg      1620
     ctggccgccg ctgaggtagc gcgcagcgcg atggccgccc acgacatcaa ccgtgaggcc      1680
     gccgcagaag cagcaaaggc ggcgcgtggt gcgaccagcg atatggccgt tgcgcgtgag      1740
     gctgcacgcg aggccgccgc cgaggcacgt cgtgcgatgc aggaagcccg cagcgaggcc      1800
     gcgcaatccg gccgcacccg tgacatgcag cgcctggcca gccagcagtc cgaactggcc      1860
     agccgacagg cggcactggg cagccaacag gccgcgttgg gcgagcgtca ggcgcgcgta      1920
     catgcgcagg catcgcagca ggcgcagcag gtgatcgcgc gcgcactggc cagcggcaaa      1980
     gccgagcgcc tctga                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page