(data stored in ACNUC7421 zone)

EMBL: CP001111.PE79

CP001111.PE79        Location/Qualifiers
FT   CDS_pept        complement(94311..95333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49784"
FT                   /db_xref="GOA:B4SRR4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR4"
FT                   /protein_id="ACF49784.1"
FT                   /translation="MSLSLDKLRLLRKQAGDPKAVTPAAPEPPPAAPAPVAANDARQPP
FT                   AERSVFAWVEQEIRHKATGAAASTPTPAPLRRPEVGSLHRLLGLRTRGGPAPARASAQD
FT                   RQLPGEEIAPGLFLIESLQPQPIPAQSMSLDFARREGEHVAPRDLLFFDTETTGLAGGT
FT                   GTRAFMIGAADWHVCPQRGEGLRIRQLLMSTMAAEDAMLATFASWLQPSTVFCSYNGRS
FT                   YDAPLLKARYRLARQRCPITALDHVDLLYPTRRRYRGTWENCKLSTIERQLLRVVREDD
FT                   LPGSEAPGAWLRFLRGGDAVNLRRVADHNHQDVVTLALLLQRLVREEQRERETLALVGQ
FT                   "
     gtgagcctga gcctggacaa gctgcgcctg ctgcggaagc aggccggtga cccgaaagca        60
     gtcacgccgg ctgcgcccga gccgccgccc gcagcgccgg caccggttgc cgccaacgat       120
     gcgcggcaac caccggccga gcgttcggtg ttcgcctggg tcgaacagga aatccgccac       180
     aaggcgactg gcgcagcggc ctccacaccg acacccgcac cgctacgtcg gccggaagtg       240
     ggtagcctgc atcgcctgct cggcctgcgc acgcgaggcg gccctgcacc tgcacgggcc       300
     agcgcgcagg atcgccagct gcctggcgag gaaatcgcac cgggcctgtt cctgatcgaa       360
     tcgctgcagc cgcagcccat tccggcgcag tcgatgtcgc tggatttcgc ccgccgcgaa       420
     ggcgaacacg tggctccacg cgacctgctg ttcttcgata ccgagaccac cggcctggcc       480
     ggcggcaccg gcacccgtgc cttcatgatc ggcgcggccg actggcatgt gtgcccgcaa       540
     cgcggcgaag gcctgcgcat ccgccaattg ttgatgtcga cgatggccgc cgaggacgcg       600
     atgctggcca ccttcgccag ctggctgcag ccgtccaccg tgttctgcag ctacaacggc       660
     cgcagctacg atgcacccct gttgaaggcg cgctaccgac tggcccgcca gcgttgcccg       720
     attacagcgc tggatcacgt cgacctgctc tatccgaccc gccgccgcta tcgcggcacg       780
     tgggagaact gcaagctgtc caccatcgaa cgccagctgc tgcgcgtggt gcgcgaggat       840
     gacctgcccg gctcggaagc gcccggcgca tggctgcgtt tcctgcgcgg cggcgacgcg       900
     gtgaacctgc gccgggtggc cgaccacaac caccaggacg tggtgaccct ggccctgctg       960
     ctgcagcggc tggtacggga agaacaacgt gaacgcgaaa ccctggcgct ggtcgggcag      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page