(data stored in ACNUC7421 zone)

EMBL: CP001111.PE83

CP001111.PE83        Location/Qualifiers
FT   CDS_pept        complement(99364..101172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49788"
FT                   /db_xref="GOA:B4SRR8"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR8"
FT                   /protein_id="ACF49788.1"
FT                   /translation="MNASAVNLWIALALALIVVIASVRQLRGDTAHPGRRWIMIALQII
FT                   VAALLYFCLVPPTRQQPAGGLVVLGTDADKASALPASEGPLLLLPEAADIPGAQRVPDL
FT                   ATALRQHPASTLTLVGAGLAARDHDALLPPDVRWQAAPEPRGWIALQPPANVAPGARFD
FT                   VQAQARGAARAKAELLDPADSVVDRTDVAEDGRVKLSGIARAEGRSVFQLRLLDADGHV
FT                   VDSVPVPQQTLPAAPLRLMVRASAPGPELKYLRRWAADAGIRVQVQADTGAGVSVGDGA
FT                   VALDAASLARSDLLLLDERSLAALSAGQLAAVRQALREGLGVLVRGAGAPSASARQRLR
FT                   DLGLPVQGDGSSRTLELPGDGDSAVLAARRGPLAAGTLPTGYGEEADRSSHNAPLPALE
FT                   ALALQAPGSTALLQDGTGKAVGGWRAAGKGRIGLLPLTDSWRWVLAGRDDRHGELWSGV
FT                   VATLARAQGSADALWSPQPIGWAGERQSLCGVQAPLQVFNKRGDDVSLIVDGATSALRC
FT                   AGWWPREPGWQRLQHGDSVVWRYVFDPKDAPALHRQAMIDATTQALASSTSANALVMQH
FT                   VPGSRWPWWLAFVLCASLLWWLERRR"
     atgaacgcct ccgctgtgaa cctgtggatt gcactggcac tcgccctgat cgtggtcatc        60
     gccagcgtgc gccagctgcg tggagacacc gcgcaccctg gccgccggtg gatcatgatc       120
     gcactgcaga tcatcgtcgc cgcgctgctg tatttctgcc tggtgccgcc cacccgccag       180
     caacccgcag gcgggctggt ggtgctcgga accgatgccg acaaggccag cgcgctcccg       240
     gccagcgaag gcccgctgtt gctgttgccg gaagctgccg atattcccgg cgcacagcgc       300
     gttcccgacc tggccaccgc gctgcgccag catccggcgt ccacactgac actggtcggt       360
     gcgggcctgg ccgcacgtga ccatgacgcg ctgctgccac cggatgtacg ttggcaggcc       420
     gcaccggagc cgcgcggctg gatcgcactg caaccaccgg ccaatgtcgc tcccggtgct       480
     cgttttgacg tccaggcaca ggcgcgtggc gcggccagag cgaaagcaga gctgcttgac       540
     cccgccgaca gcgtggttga tcgcacggac gttgccgagg acgggcgcgt gaagctcagc       600
     ggcatcgccc gcgccgaagg ccgcagcgtg ttccagctgc gcctgctcga tgccgacggc       660
     catgtggtgg acagcgtacc ggtgccgcag cagaccctgc cggccgcacc gctgcgcctg       720
     atggtgcgcg ccagtgcgcc gggtccagag ctgaagtacc tgcggcgttg ggcggccgat       780
     gccggcatcc gcgtgcaggt gcaggccgat accggggcgg gtgtcagcgt gggagatggc       840
     gcggtcgcgc tggatgcggc gtcactcgcg cgcagcgatc tgctgctgct ggacgagcgc       900
     agcctggccg cattgagtgc cggccagctg gctgccgtgc ggcaggcgtt gcgcgaggga       960
     ctgggcgtgc tggtacgcgg tgcgggcgca ccttcggcca gcgcgcgcca gcgcctccgc      1020
     gatctgggcc tgccggtgca gggcgatgga agcagccgca ccctcgaact tcccggcgac      1080
     ggcgacagcg cggtcctcgc tgcacggcgt ggcccgctcg ccgcgggtac gctgccgacc      1140
     ggctacggcg aagaggctga ccgcagctcg cacaatgctc ccctgcctgc gctggaagca      1200
     ctcgcgctgc aggcaccggg cagcaccgcc ctgctgcagg atggcacggg caaggctgtc      1260
     ggtggctggc gcgctgccgg caagggccgc atcggcctgc tgccgctgac cgacagctgg      1320
     cgctgggtac tggccgggcg cgacgatcgc cacggcgaac tgtggagcgg cgtggtggcc      1380
     acgctggcac gtgcacaggg cagcgctgat gcgctgtggt caccgcaacc gatcggctgg      1440
     gcaggcgaac gacaatcgct gtgcggtgtg caggcgccgc tgcaggtctt caacaagcgt      1500
     ggcgacgatg tatccctgat cgtcgatggc gcgacgtcgg cgctgcgctg cgctggctgg      1560
     tggccccgcg aaccgggctg gcagcgcctg cagcacggcg acagcgttgt ctggcgctat      1620
     gtgttcgacc cgaaggacgc acccgcactg catcggcagg cgatgatcga tgcaaccact      1680
     caggcgttgg cctccagtac gtcggcgaac gcgttggtga tgcagcacgt gccgggctcg      1740
     cgctggccct ggtggctggc gttcgtgttg tgcgcatcgc tgctgtggtg gctggaacgg      1800
     cgacgctga                                                              1809
//

If you have problems or comments...

PBIL Back to PBIL home page