(data stored in ACNUC7421 zone)

EMBL: CP001111.PE84

CP001111.PE84        Location/Qualifiers
FT   CDS_pept        complement(101169..103355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49789"
FT                   /db_xref="GOA:B4SRR9"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRR9"
FT                   /protein_id="ACF49789.1"
FT                   /translation="MKTLQHAWQRARRRRAAITLLLGLPWALAATALALRLSGFDIACV
FT                   VATVSLLACAAFATARARQLDRQWLQRQLDGSGASEDSADLLFADAAALNPLQQRQRAH
FT                   VLATLERAMPELRPRWPHLAVMLCWIGGLAVALLAFGWPRSNPDPAAVHSATTGSTASA
FT                   GPLQLQSSRLRIDAPAYTGQATLTQSTLDAKVAADSQLSWSLRFDRAPAKAWLQFHDGR
FT                   RLPLSEHDGQWQAQDVARTPVLYRVVSEPALAETRLYRLDVVADRAPSVRVLEPSASLV
FT                   LGTPGQRQWALRFEASDDYGVAAQATLSITTTQGSGENITFVKRSVTLAGSGEATARRF
FT                   AHTLDLAALGAQPGNDVIAQLEVRDNHAPTPQTGRSSSVILRLPSAEVALGAELEGRIK
FT                   KTLPAYFRSQRQIIIDAEALIRQRRSLAAEDFVKRSDAIGVDQRILRLRYGQFLGEESE
FT                   GAPKPPPTSDLPTSDTPAADDHDHDHDHDDDHDHDHGAEAGAHDEHGHDHGGKASNADT
FT                   PPVFGSATDVLSEYGHTHDHAEAATLLDPQTRATLKAALDQMWSAEGELRQGRPEQALP
FT                   FAYKALGFIKQVQQAERIYLARVGPELPPIDEGRRLGGDRAGLASRELPLAARTPPDPA
FT                   IVEAWQRLGDDTGAPDLDALATWQQRNAAYLPDALDLAAAIEQLRIEPGCHDCRQRLRA
FT                   QLWRALQRPLPQVMRRSAADAMGQRYLDALEAQP"
     atgaagacgc tgcagcatgc ctggcaacgt gcgcgtcgtc gccgcgccgc catcaccctg        60
     ctgctgggcc tgccgtgggc gctggctgcg acggcgctcg cactgcggct gtccggtttc       120
     gatatcgcct gcgtggtcgc cacggtcagc ctgctcgcct gcgcggcctt cgccactgca       180
     cgtgcccgcc agctggaccg ccagtggctg cagcgccagc tcgatggcag cggtgccagc       240
     gaggacagcg ccgacctgct gttcgccgac gccgccgcac tcaatccgct gcagcagcgc       300
     cagcgtgcgc atgtgctggc cacgctggaa cgcgcgatgc cggagctgcg tccgcgttgg       360
     ccgcacctgg cggtgatgct gtgctggatc ggtggcttgg ccgttgccct gctcgcgttc       420
     ggctggccgc gttcgaaccc agacccggca gccgttcatt ccgccacgac cggcagcacg       480
     gcgtccgcag gcccgctgca actgcagtcc agtcgcctgc gcatcgacgc accggcttac       540
     accgggcaag ccacgctgac gcagagcacg ctggatgcaa aggtcgccgc cgacagccag       600
     ctgtcgtggt cgttgcgctt cgaccgcgca ccggccaagg catggctgca gttccacgat       660
     ggtcgccggt tgccgctgag cgagcacgat ggacagtggc aggcgcagga tgtggcacgc       720
     acgccggtgc tgtaccgcgt ggtgagcgaa ccggcgctgg ccgaaacccg cctgtaccgg       780
     ctggatgtag tggccgaccg cgcgcccagc gtgcgcgtgc tggagccctc cgccagcctg       840
     gtgctgggca cgccggggca acgccagtgg gcgctgcgct tcgaggccag cgacgattac       900
     ggtgtcgcgg cgcaggcaac gctgtcgatc accaccaccc agggcagcgg cgagaacatc       960
     accttcgtga agcgcagcgt cacgcttgcc ggcagcggcg aagccaccgc gcggcgtttc      1020
     gcccacaccc ttgatctggc tgcgctgggc gcacaaccgg gcaacgatgt catcgcccag      1080
     ctggaggtgc gcgacaacca tgcgcccacg ccgcagaccg gacgcagcag cagcgtgatc      1140
     ctgcgcctgc ccagcgccga agtcgcactc ggtgcagagc tggaaggccg catcaagaag      1200
     accctgccgg cctacttccg cagccagcgg cagatcatca tcgatgccga agcgctgatc      1260
     cggcaacgac gcagcctggc cgccgaggat ttcgtgaagc gcagcgatgc gatcggtgtc      1320
     gaccagcgca tcctgcgcct gcgctacggc cagttcctgg gtgaggaaag cgaaggtgcg      1380
     ccgaagccac cgccgaccag cgacctgccc accagcgata cgcccgccgc agacgaccac      1440
     gaccacgacc acgatcacga cgacgatcac gatcacgacc atggcgccga ggccggagcg      1500
     cacgatgagc atggccacga tcacggcggc aaggcgtcca atgccgatac gccaccggtg      1560
     ttcggcagcg ccaccgacgt gctctccgag tacggccaca cccatgacca tgccgaggcg      1620
     gccactctgc tcgatccgca gacccgtgcc acgctgaagg cagcgcttga ccagatgtgg      1680
     tcggccgaag gcgagctgcg ccagggccgc ccggagcagg cgctgccgtt tgcctacaag      1740
     gcattgggct tcatcaagca ggtgcagcag gccgagcgca tctatctggc ccgggtcgga      1800
     ccggagctgc caccgatcga tgaaggccgc cgcctcggcg gtgaccgtgc cgggctggcc      1860
     agtcgtgaac tgccgctggc cgcccgcacc ccgcccgatc cggccatcgt agaagcctgg      1920
     cagcgtctcg gcgacgacac cggcgcgccg gatctggatg cgctcgcgac ctggcagcag      1980
     cgcaacgcgg cctacctgcc cgatgcactc gatctggctg cggccatcga gcagctgcgc      2040
     atcgagcccg gttgccacga ctgtcgccag cgcctgcgtg cacagttgtg gcgggcgctg      2100
     cagcgtccgc tgccgcaggt gatgcggcgc agtgccgccg atgcgatggg gcagcggtac      2160
     cttgatgcgc tggaggcgca gccatga                                          2187
//

If you have problems or comments...

PBIL Back to PBIL home page