(data stored in ACNUC7421 zone)

EMBL: CP001111.PE85

CP001111.PE85        Location/Qualifiers
FT   CDS_pept        complement(103352..104473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0085"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical membrane protein;
FT                   PFAM: protein of unknown function DUF1550; KEGG:
FT                   xac:XAC0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49790"
FT                   /db_xref="GOA:B4SRS0"
FT                   /db_xref="InterPro:IPR011933"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS0"
FT                   /protein_id="ACF49790.1"
FT                   /translation="MTLLFPLGLAALAAWLLPLLIHLARRHPYTPLDFAALRWLRAQIR
FT                   PRQRIRFDDWPLLLVRLLLLAALALLLARPALTGPAPAPTAWTVVAPGLDATALRGTAE
FT                   AGNWHWLAPGFPAIDQVPPASTASLPSLLRELDAQLPVGTALTVHVPDPLPGLDGARLQ
FT                   LSREVQWHTQPMPVTAQPRAATSPRLRVHSDASAAAQHWLNALQRAWGVQAPLAPLVAD
FT                   ALPERGEIGVWSRNDALPANWQAWLQDGGSVLIAAKPATEAQVLLRSAEGVPLLWQQRV
FT                   GLGRLLSLPGDWDAASNTALRDPQLPRSLLLALQPPPSPRVGDAQDQAPRQIALPAAAS
FT                   PVREPTAWLLLAIVLLFALERWMASSARRRAIA"
     atgaccctgc tgttcccatt gggtctggcc gcgctcgccg catggctgct gccgctgctg        60
     atccacctcg cccgccgcca tccgtacaca ccgctggatt tcgctgcgct gcgctggctg       120
     cgcgcacaga tccggccacg ccagcgcatc cgcttcgatg actggccatt gctgctggtg       180
     cgcctgctgt tgcttgccgc gctggctttg ctgctggcac ggcctgcgtt gaccgggcct       240
     gcaccagccc ccactgcgtg gacggtcgtt gctccagggc tggacgcgac cgctctgcgc       300
     ggcaccgccg aagcgggcaa ctggcattgg ctggcgccgg gcttcccggc cattgatcaa       360
     gtgccacctg cgtccacggc ctccctgccc agcctgctgc gcgaactgga cgcgcagctg       420
     cccgttggca ccgcattgac cgtgcacgtt cccgatcccc tgcccggcct ggatggcgcc       480
     cgcctgcagc tgtcgcgtga ggtgcaatgg cacacgcagc cgatgccggt cactgcgcaa       540
     ccgcgtgccg caacgtcgcc gcgcctgcgc gtgcacagcg atgcttcggc cgctgcccag       600
     cactggttga atgcactgca gcgcgcgtgg ggcgtgcagg cgccgctcgc tcctctggtg       660
     gcggatgccc tgcccgaacg cggcgagatc ggcgtatgga gccgcaacga cgcactgccg       720
     gcgaactggc aggcgtggct gcaagatggc ggcagtgtgc tgatcgccgc caagcccgcc       780
     acggaagccc aggtcctgct gcgcagcgcc gaaggcgtgc cgctgttgtg gcagcaacgt       840
     gtcggccttg gccgcctgct gtcactaccg ggtgattggg atgccgccag caacaccgcg       900
     ctgcgcgatc cacagctgcc gcgttccctg ctgctggccc tgcagccgcc gccgtcgcca       960
     cgcgtgggcg atgcacagga ccaggcgccg cgccagattg cactgcccgc cgcagcatcg      1020
     ccggtgcgtg agcccacggc gtggcttctg ctggcaatcg tgctgctgtt cgcactggaa      1080
     cgctggatgg ccagcagcgc gcggcgcagg gcgatcgcat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page