(data stored in ACNUC7421 zone)

EMBL: CP001111.PE86

CP001111.PE86        Location/Qualifiers
FT   CDS_pept        complement(104470..105366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0086"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   xcb:XC_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49791"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS1"
FT                   /protein_id="ACF49791.1"
FT                   /translation="MNAGTSLTLPPELRARLRLLRLRPRLASGASGIGQHASRSRGAGL
FT                   EFAQYRAYEPGDELRQIDWKLYARSDRFFVRESERESPITVWLLLDATASAGQADRAAP
FT                   ERTRLDHMRGVAACLVELALQQGDRFGLLAINGDGLQLVPAASGARQRDRVHLQLHALQ
FT                   ARGGWPSADRLRPLWERVRPGDMLLAIGDGFDEAGIVLLEQLASARREVALLQILTADE
FT                   RDFPFDAGHRFRDPETGEELLGDGAAIRADYLQRFADARSALQSRLQASGIASATGWLD
FT                   QPLDQPLQALFGRGGGA"
     gtgaacgctg gtacgtcgtt gaccctgcca cccgaactgc gcgcgcgcct gcgcctgctg        60
     cggttgcggc cgcgcctggc cagcggtgcg agcggcattg gccagcacgc cagccgcagc       120
     cgtggtgccg gcctggagtt cgcccagtac cgggcctacg agccgggtga cgaactgcgc       180
     cagatcgact ggaagctgta tgcgcgctcg gaccgcttct tcgtgcgcga atccgaacgc       240
     gaaagcccga tcacggtctg gctgctgctc gatgccaccg cttcggccgg tcaggccgac       300
     cgcgcggcgc cggaacgcac gcgcttggac cacatgcgcg gcgttgccgc ctgcctggtc       360
     gaactggccc tgcagcaagg cgaccgtttc ggcctgctgg cgatcaatgg cgatggactg       420
     cagctggtgc ccgcagcgag cggcgcacgc caacgtgacc gcgtgcacct tcaacttcat       480
     gcgctgcagg cgcgcggcgg ctggccatcg gcggatcgac tacgcccgct gtgggaacgc       540
     gtacgccccg gcgacatgct gctggccatt ggcgatggct ttgatgaagc cggcatcgtg       600
     ctgctggaac aactggccag cgcgcgccgt gaagtggccc tgctgcagat cctgactgcc       660
     gacgaacgcg acttcccgtt cgatgccggc caccgcttcc gcgatccgga aaccggcgag       720
     gaactgctgg gcgatggtgc ggcgatccgc gccgactacc tgcagcgctt cgccgacgca       780
     cgcagtgcgc tgcagtcgcg cctgcaggcc agcggcatcg ccagcgccac cggctggctc       840
     gaccagcccc tggaccaacc actgcaggcg ctgtttggcc gtgggggcgg tgcatga          897
//

If you have problems or comments...

PBIL Back to PBIL home page