(data stored in ACNUC7421 zone)

EMBL: CP001111.PE89

CP001111.PE89        Location/Qualifiers
FT   CDS_pept        complement(107081..108415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0089"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   xac:XAC0120 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49794"
FT                   /db_xref="GOA:B4SRS4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS4"
FT                   /protein_id="ACF49794.1"
FT                   /translation="MSIFTEAQAKAILDKVIALSKADECTAVLAGAINGNIRFALNNVS
FT                   TSGIVDNTELAVTVAFGKRVGTASINEFDDAALERVVRRAEDLARLAPENPEFMPAIGK
FT                   QSYRASPTFSESTAAIDPAFRAKVAADSIAPCRGHGLIAAGFLEDGQGFQATANSNGNF
FT                   AYQRTTNFDYTCTVRTEDGRGSGWVGRNLKDAADFKADQDIRIAMRKATESAEAKALEP
FT                   GKYTVILEPAAAAGLISFMMNFFSARSADEGRSFLSKKGGGNKLGEQVYDPRVTMFADP
FT                   WHPDAPVLPWDNEGMPRERIAIIENGKIANLDYSRFWAQKQGKTAKASPGNLLMSGGDK
FT                   STAELVRGTQKGILVTRTWYIRMVDPQTVLLTGLTRDGTFYIENGQIKHPVKNFRFNES
FT                   PVIMLNNIEELGKPVRVAGDESNYVMMIPPMKLRDFTFTSLSDAV"
     atgagtatct tcaccgaagc ccaggccaag gccatcctcg acaaggtcat cgccctgtcc        60
     aaggccgatg agtgcaccgc cgtactggcc ggtgcgatca acggcaacat ccgtttcgcg       120
     ctgaacaatg tctccaccag cggcatcgtc gacaacaccg aactggcggt gaccgtcgcc       180
     ttcggcaagc gcgtcggcac cgcctcgatc aacgagttcg acgatgccgc gctggaacgc       240
     gtggtacgcc gcgccgaaga cttggcgcgc ctggcgccgg agaacccgga gttcatgccg       300
     gccatcggca agcagagcta tcgcgccagc ccgaccttca gcgaatccac tgcagcgatc       360
     gatccggcct tccgcgccaa ggtcgccgcc gattcgatcg ccccgtgccg tggccacggc       420
     ctgatcgccg ccggcttcct cgaagacggc cagggcttcc aggccaccgc caacagcaac       480
     ggcaacttcg cctaccagcg caccaccaac ttcgactaca cctgcaccgt gcgtaccgaa       540
     gacggccgcg gttcgggctg ggtcggccgc aacctgaagg acgcagcgga cttcaaggcc       600
     gaccaggaca tccgcatcgc catgcgcaag gccaccgagt cggccgaagc caaggcgctg       660
     gagccgggca agtacacggt gatcctggaa ccggccgcag ccgcgggcct gatcagcttc       720
     atgatgaact tcttcagcgc acgctcggcc gatgaaggcc gcagcttcct gtcgaagaag       780
     ggcggcggca acaaactggg cgagcaggtc tacgatccgc gcgtgaccat gttcgccgac       840
     ccgtggcacc cggacgcacc ggtgctgccg tgggacaacg agggcatgcc acgcgagcgc       900
     atcgccatca tcgaaaacgg caagatcgcc aacctggact actcgcgctt ctgggcccag       960
     aagcagggca agaccgccaa ggcctcgccg ggcaacctgc tgatgagcgg tggcgacaag      1020
     agcaccgccg agctggtgcg cggcacccag aagggcatcc tggtcacccg tacctggtac      1080
     atccgcatgg ttgatccgca gaccgtgctg ctgaccggcc tgacccgcga cggcaccttc      1140
     tacatcgaga acggccagat caagcacccg gtgaagaact tccgcttcaa cgagtcgccg      1200
     gtgatcatgc tcaacaacat cgaagagctg ggcaagccgg tgcgcgtggc cggcgatgaa      1260
     tccaactacg tgatgatgat cccgccgatg aagctgcgcg atttcacctt cacctcgctg      1320
     tccgacgccg tctga                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page