(data stored in ACNUC7421 zone)

EMBL: CP001111.PE92

CP001111.PE92        Location/Qualifiers
FT   CDS_pept        112416..113030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0092"
FT                   /product="protein of unknown function DUF938"
FT                   /note="PFAM: protein of unknown function DUF938; KEGG:
FT                   xoo:XOO0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49797"
FT                   /db_xref="InterPro:IPR010342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS7"
FT                   /protein_id="ACF49797.1"
FT                   /translation="MSSKPYSEACERNREPIAAALDPWMGDRHRVLEIGSGTGQHAAFF
FT                   AERWPWLRWQPSDHPDHLPGIEARRAEAALLNLLPPVALQVELPPAPGLSLPEGSTFDA
FT                   AFSANTLHIMSWEHVQALFAALPSVMRHGALLAVYGPFNYGGRYTSDSNAQFDAWQRTR
FT                   DPRSGIRDSEAVQALAADNGFTRLGDVAMPANNRLLLWRLG"
     atgtcgagca agccgtattc agaagcctgc gaacgcaacc gcgaaccgat cgccgctgcg        60
     ctcgacccgt ggatgggaga tcgccaccgg gtgctggaga tcggcagtgg caccggccag       120
     cacgcggcct tcttcgccga acgctggccg tggctgcgct ggcagcccag cgatcatccg       180
     gaccatctgc ccggcatcga ggcccggcgt gcggaggccg cgctgctcaa tctgctgccg       240
     ccggtggcgc tgcaggtgga actgcccccg gcgccgggcc tgtcgttgcc cgagggcagc       300
     acgttcgatg ccgcattcag cgccaacacg ttgcacatca tgagctggga gcacgtgcag       360
     gcgctgttcg ccgcgctgcc atcggtgatg cgccacggcg cgctgctggc ggtgtacggc       420
     ccgttcaact acggcggtcg ctacaccagc gacagcaacg cgcagttcga tgcgtggcag       480
     aggacgcgcg atcctcgtag cggcatccgc gatagcgaag cggtgcaggc gctggcggcc       540
     gacaatggct tcacccgcct gggtgacgtg gcgatgccgg ccaacaaccg cctgctgctg       600
     tggcggctgg gctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page