(data stored in ACNUC7421 zone)

EMBL: CP001111.PE94

CP001111.PE94        Location/Qualifiers
FT   CDS_pept        complement(114357..114614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0094"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   rso:RSp1252 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49799"
FT                   /db_xref="GOA:B4SRS9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRS9"
FT                   /protein_id="ACF49799.1"
FT                   /translation="MDRPLHTVRTPQQLAPLMRAFRRQAGLSQAQLAAQLGISRQAVGA
FT                   LERDPASASFERLMRVWAVLGLEVRLQQRSPPETTSTLEW"
     atggacaggc cgctgcacac ggtgaggaca cctcaacaac tggcaccgct gatgcgtgcg        60
     ttcaggcgcc aggcgggcct gagccaagcg cagttggcgg cacagctcgg cataagccgc       120
     caggcagtag gcgcattgga gcgcgacccg gcatcggcaa gcttcgaacg gctgatgcgg       180
     gtctgggcag tgctgggtct ggaagtcaga ttgcagcagc gaagtccccc ggagacaacg       240
     tcaacgttgg agtggtga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page