(data stored in ACNUC7421 zone)

EMBL: CP001111.PE96

CP001111.PE96        Location/Qualifiers
FT   CDS_pept        118628..119263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49801"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT1"
FT                   /protein_id="ACF49801.1"
FT                   /translation="MSVSGKILASVLLASGAATAWAAPALPAPQEFYFDSDLAATPMVA
FT                   IQGEGDELVTQLVKLRERGRRAVEATVQLASVAGAQGRSELAEQLYGEALKEASAQSSS
FT                   GRSVRWNYGWDLLRQGRVEAALEQWLSSAGNARTKPSWVPPTYALALWRLGQKQEAVQW
FT                   YAAAVRTEPSQWNTTANYGQLLPQWREDERATLAEVQQAWAAAPPVWP"
     atgtcagttt caggaaagat cctggccagc gtgctgctgg cttcgggagc ggccactgcg        60
     tgggccgcgc cggccctgcc ggcaccacag gagttctact tcgacagcga cctggccgcc       120
     acgccgatgg tggcgataca gggcgagggc gatgagctgg tcacccagct ggtcaagctg       180
     cgtgaacgcg gccggcgcgc ggttgaggcg acggtgcagc tggcgtcagt ggctggcgcc       240
     cagggccgca gcgagctggc cgagcagctg tatggcgaag ccttgaagga ggcatcggca       300
     cagagcagca gtggccgcag cgtgcgctgg aactacggat gggatctgtt gcgccagggc       360
     agggtggagg cggcactgga acagtggctt tcatcggccg gcaacgcccg taccaagccc       420
     agctgggtgc caccgaccta cgcgctggcg ctgtggcggc tggggcagaa gcaggaggca       480
     gtgcagtggt acgccgctgc ggtgcgtacc gagccgtcgc agtggaatac cacggccaac       540
     tatgggcagc tgctgccgca gtggcgtgag gatgagcgcg cgacgctggc tgaggtgcag       600
     caggcctggg cggccgcacc acctgtctgg ccctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page