(data stored in ACNUC7421 zone)

EMBL: CP001111.PE97

CP001111.PE97        Location/Qualifiers
FT   CDS_pept        complement(119856..121340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0097"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: pap:PSPA7_0798 probable ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49802"
FT                   /db_xref="GOA:B4SRT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT2"
FT                   /protein_id="ACF49802.1"
FT                   /translation="MSELQDLSALIRANTPLIVIETQDEGRIVELFRQTLMHVWRALHR
FT                   WSITEGLRRIDLDSEDPAVGPPDASAALQMIRQADQRGVYLLLDFHPYLGYASHQRALR
FT                   DLIQRRHSEPHVLVLIGAKVELPAELEALAVRFNPRLPDANALLKMLREEADAYAREHG
FT                   GRRVEVDSEAVKKILKNLQGLSLVDARRIARQLIYADGALRDDDLPQLARLKFELLNRS
FT                   GHLFFEHDSARFGDVAGANRLKRWINQRRVAFIAGSAPAGLDPPRGMLLLGVQGCGKSM
FT                   LAKATAAGFGVPLLRLDVGALYNKYHGETEANLRQALASAEQLAPCVLWMDEIEKGLAS
FT                   GGEDGGVSRRVLGYLLTWMAERKAPVFIVATANQVHELPAELLRKGRFDEIFFVDLPSP
FT                   EVRVELLRLHLGRRQLNADDFALPALAAAANGFSGAEIEQAIVAGLYAAHAEGRPLDTE
FT                   LLMNEIRATRPLSVLMAEQVEALRAWASGRTVSADD"
     atgagcgaac tgcaggacct gagcgcactg atccgcgcca atacccccct gatcgtgatc        60
     gagacccagg atgagggtcg catcgtcgaa ctgttccggc agacgctgat gcacgtctgg       120
     cgggccctgc accgctggtc gatcaccgag ggcctgcgcc gcatcgacct ggacagcgag       180
     gacccggcgg tcgggccgcc cgatgccagt gcggccctgc agatgatccg ccaggccgac       240
     cagcgcgggg tctacctgct gctcgatttc cacccctacc tgggctatgc cagccaccag       300
     cgcgccctgc gcgacctgat ccagcgccgc cacagcgagc cgcacgtgct ggtgctgatc       360
     ggtgccaagg tcgaactgcc ggccgagctg gaagcgctgg cggtacgctt caacccgcgc       420
     ctgcccgatg ccaacgccct gttgaagatg ctgcgcgagg aggccgatgc ctatgcacgc       480
     gagcatggtg gtcgtcgggt tgaagtcgac agcgaagcgg tcaagaagat cctgaagaac       540
     ctgcagggcc tgagcctggt cgatgcccgg cgcatcgcgc gccagctgat ctacgccgac       600
     ggcgcactgc gcgacgacga cctgccgcag ctggcgcggc tgaagttcga gctgctcaac       660
     cgcagcggcc acctgttctt cgaacatgac agcgcgcgct tcggcgacgt ggccggagcg       720
     aaccggctca agcgctggat caaccagcgc cgggtcgcat tcatcgccgg ctcggcgccg       780
     gccgggctgg acccgccgcg cggcatgctg ttgctgggcg tgcagggctg cggcaagtcg       840
     atgctggcca aggcaaccgc cgccggcttc ggcgtgccgt tgctgcgcct ggacgtaggc       900
     gcgctgtaca acaagtacca cggcgagacc gaagccaacc tgcgtcaggc actggcctca       960
     gccgagcagc tggcgccctg cgtgctgtgg atggacgaga tcgaaaaggg cctggccagc      1020
     ggaggcgagg acggcggcgt gtcacgccgc gtgctcggtt acctgctgac ctggatggcc      1080
     gaacgcaaag cgccggtgtt catcgtcgcc accgccaacc aggtacacga actgccggcc      1140
     gagctgctgc gcaaggggcg cttcgacgag atcttcttcg tcgacctgcc ctcgccggag      1200
     gtccgcgtgg aactgctgcg gctgcacctg ggccggcgcc agctcaacgc cgatgatttc      1260
     gcactgcccg cgctggcggc ggccgccaat ggtttttccg gcgccgagat cgagcaggcg      1320
     atcgtggccg gcctgtatgc ggcacatgcc gagggccggc cgctggacac cgagctgctg      1380
     atgaacgaga tccgcgccac gcgcccgctg tcggtgctga tggccgagca ggtggaagca      1440
     ctgcgggcgt gggcgtcggg gcggacggtt tccgcggacg actga                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page