(data stored in ACNUC7421 zone)

EMBL: CP001111.PE98

CP001111.PE98        Location/Qualifiers
FT   CDS_pept        121464..122093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Smal_0098"
FT                   /product="partition protein"
FT                   /note="KEGG: xcb:XC_0183 partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Smal_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACF49803"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B4SRT3"
FT                   /protein_id="ACF49803.1"
FT                   /translation="MKTILVAGSKGGVGKTTVATHLAAYAALQGKATVIADADPQGSST
FT                   RWAQRRAGLESAVLPIDVYRKKQWAQKLPDGTETVIIDAPAGALADDIPHFLDAADAVV
FT                   VPVLPSALDIEAIVGFLNSLAQNPRVHSRKLPVGLVLNRTKPWTQTSQQALQMLSEWPY
FT                   PVVAQLRDSQSYVVMTGLGRSLFDYRSAQVREHQADWEPLLSWLKL"
     atgaagacga tcctggtggc cggttccaag ggcggggtgg gcaagaccac cgtcgccacc        60
     cacctggccg cgtacgcggc attgcagggc aaggccacgg tgatcgccga tgccgacccg       120
     cagggctcca gcacccgctg ggcgcaacgg cgtgccgggc tggaaagcgc ggtgctcccc       180
     atcgacgtgt atcggaagaa gcagtgggcg cagaaactgc ccgacggcac cgaaaccgtc       240
     atcatcgatg ccccggccgg ggcgttggcc gacgatatcc cccatttcct tgacgctgcc       300
     gacgcggtgg tggtgccggt gctgccctcg gcgctggaca tcgaagccat cgtcggcttc       360
     ctcaacagcc tggcccagaa cccgcgcgtg cacagccgca agctgccggt ggggctggtg       420
     ctgaaccgca ccaagccctg gactcagacc tcgcagcagg cgctgcagat gctgtccgaa       480
     tggccgtacc cggtggtcgc gcagctgcgc gacagccaga gctacgtggt catgaccggc       540
     ctgggccgca gtctgttcga ttaccgctcc gcccaggtgc gcgagcacca ggccgactgg       600
     gaacccctgt tgtcctggtt gaagctgtaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page