(data stored in ACNUC7421 zone)

EMBL: CP001115.ALX

CP001115.ALX         Location/Qualifiers
FT   CDS_pept        complement(102246..103268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alx"
FT                   /locus_tag="Deide_1p00590"
FT                   /product="putative TerC family protein; putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47462"
FT                   /db_xref="GOA:C1D223"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C1D223"
FT                   /protein_id="ACO47462.1"
FT                   /translation="MEFLLDLWLGKPAWMWLMFITLVMALLAFDLGVLGKRREAQAASG
FT                   AGQPHEIGVKASLKLSLFYISVALLFGVWVWSTLGPQSGIEYLTGFAVEKALALDNVFV
FT                   ISVIFGALAIPRHLQHRVLVWGILGVIVLRGLMIGLGTALVTQFDWIMWVFGAFLLLTG
FT                   IKLLLARGGHSDAPDLERHPVVRLLKRIIPVSSELDGQKFLTRLPEAGGRRRLHATPLL
FT                   LALVLVEAADLVFAVDSIPAIFAITQDPFLVYTSNIFAILGLRALYFALDALIHRFEAL
FT                   KPALALVLMFIGGKIFYTQLFGKMDPALSLGITLSILAGGILTSLWKNRTPGPAAKPQL
FT                   "
     atggaattcc ttcttgacct ctggttgggc aaacccgcct ggatgtggct gatgtttatc        60
     accctggtca tggccctgct ggcttttgac ctgggcgtcc ttggaaagcg ccgcgaggcc       120
     caggctgctt caggtgcagg gcagccccac gagattgggg tgaaagcgag cctcaaactg       180
     agtctcttct acattagcgt tgccctgctg ttcggggtgt gggtctggtc gacgcttggc       240
     ccccagagcg gtatcgagta cctgactggc ttcgctgtcg agaaggcact ggcgctcgac       300
     aacgtctttg tcatcagtgt gatttttgga gcactggcca ttcccagaca cctgcaacac       360
     cgggttctgg tgtggggcat tctcggtgtc atcgtcctgc gtgggctgat gattgggctc       420
     ggtacggctc tggtgaccca gttcgactgg atcatgtggg tgttcggcgc cttcctcctg       480
     ctgaccggca tcaaattgct gctggccaga ggtggccatt cggacgcgcc cgatctcgaa       540
     cgtcatccgg tggtgcggct gctcaaacgc atcattcccg tgagttccga gcttgacggc       600
     cagaagttcc tgacccggct gccggaggcc ggcggtcggc ggcgtctgca cgccacgccc       660
     ctgcttctgg ccctggttct ggtggaagca gcggacctgg tgttcgcagt tgattcgatc       720
     ccagctatct tcgccattac acaagaccct tttctggtct acaccagcaa catctttgcc       780
     atccttggcc tgcgtgccct gtactttgcc ctggacgcac tgattcaccg cttcgaagcc       840
     ttgaagccag cgcttgccct ggtcctgatg tttattggcg gcaagatttt ctacactcag       900
     cttttcggca agatggaccc ggcactgagc ctggggatca cgctcagtat cctggcgggc       960
     ggtatcctga caagcctgtg gaagaaccgt accccaggac cggcagccaa accacagcta      1020
     tag                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page