(data stored in ACNUC7421 zone)

EMBL: CP001115.CHEB

CP001115.CHEB        Location/Qualifiers
FT   CDS_pept        80456..81496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="Deide_1p00470"
FT                   /product="putative protein-glutamate methylesterase (CheB
FT                   methylesterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47446"
FT                   /db_xref="GOA:C1D207"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR011247"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C1D207"
FT                   /protein_id="ACO47446.1"
FT                   /translation="MTDFPLVVIGASAGGVSALMKLCAQLPSSFPAAVLVVQHVSPAHP
FT                   SMLPRILSAAGTLHAIHPRDGQTLHPGMIYVAPPDHHLLVDGETVLLSRGPRENRSRPA
FT                   IDVLFRSAAVEAGSRVIGVVLTGNLDDGTSGLHVIKQAGGLAVVQDPDDAEFASMPRSA
FT                   LNAVKVDHVAPLSELGALLASLVDDRARNHRPTPLASEDVRRLEVELGVAREEHALSKG
FT                   VTRLGAPSPLTCPECHGTLIEIREGTLVRFRCHSGHAYTAGTLLTEVSESVESKAYQAL
FT                   RALGETVILLRQLSDQRQKQGDPAGAEAFLARAREVEASSEGIRALVRTTRALSVEKVE
FT                   RPDFDG"
     atgacggact ttcccctggt ggtcattggg gcctcagctg gtggtgtctc ggccctgatg        60
     aaactctgtg cccaacttcc cagctccttt ccggccgcag tgctggtggt ccagcacgtc       120
     tccccggccc atcccagcat gctccccaga atcctcagtg ccgctggcac cctgcacgcc       180
     atccatcccc gtgatggcca gacgctgcat cctggaatga tctacgtcgc tccgcctgac       240
     catcacctgc tggtggatgg tgaaaccgtc ctgctgtccc ggggccccag agaaaaccgc       300
     tcccgtcccg ccattgacgt tctgttccgc tcggcggcag tcgaggcagg gagccgcgtg       360
     atcggggtgg tcctgactgg aaacctggat gatggcacgt ccggccttca tgtcatcaaa       420
     caggccggcg gtctggccgt ggtgcaggac ccggatgacg cagagttcgc ctcgatgcca       480
     cgtagcgctc tgaatgctgt gaaggttgac cacgttgcgc cgctctcgga actgggagcg       540
     ctgctggcta gcctggtgga tgaccgagcc aggaaccaca gacctacacc gctggcctct       600
     gaggacgtac gccgccttga agttgagctg ggggttgccc gggaagagca tgccctgagc       660
     aaaggggtga cccggctggg cgcaccgtcg ccgctgacct gtccggagtg tcacggcacc       720
     ttgatcgaga ttcgggaagg cacccttgtg aggttccggt gccactctgg tcatgcctac       780
     acggcaggca ccctgctgac cgaagtcagt gagtcggttg agtccaaggc ttatcaggcg       840
     ttgcgggcac tgggagaaac ggtgattctg ctccggcaac tgagcgatca gcgccagaag       900
     cagggcgacc cggcgggagc agaagcattt ctggcgcggg cccgtgaggt ggaggccagc       960
     agtgaaggca tccgcgccct ggtgcggaca accagagccc tgagtgtcga gaaggtagag      1020
     cggccggact tcgacggctg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page