(data stored in ACNUC7421 zone)

EMBL: CP001115.PCAH

CP001115.PCAH        Location/Qualifiers
FT   CDS_pept        complement(234285..234998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="Deide_1p01330"
FT                   /product="putative protocatechuate 3,4-dioxygenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47576"
FT                   /db_xref="GOA:C1D2D7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:C1D2D7"
FT                   /protein_id="ACO47576.1"
FT                   /translation="MTDPQHRPSAHPPHLYPPYTSSIKRAPHELLIPLPAALRDHRGPV
FT                   FGTDRIRPDDHDTTRNARMNGEPLGERIIVRGRLLDSAGRPVRGALIETWQANAAGRYI
FT                   HKQDQHAAPLDPNFTGTGRMLTDEHGEYELISIRPGAYPWRNHHNAWRPAHIHFSVFGT
FT                   NFTQRLVSQMYFPGDPLLAYDPIYQGIPDEKGRQRLISRFDLNITRPEWALGYRFDIVL
FT                   GGEAQTPFEEPDHEH"
     atgaccgacc cacagcaccg gcccagcgcc catccgccac atctgtatcc gccgtacacc        60
     agcagcatca aacgcgcgcc gcacgagctc ctgattccgc ttcccgccgc gctgcgcgat       120
     caccggggcc cggtgttcgg cacagaccgg atccgtcccg acgatcacga caccacccgc       180
     aacgcccgca tgaacggtga accgcttggg gagcgcatca tcgtccgggg gcggttgctg       240
     gacagcgcag gacgtcccgt tcgcggcgcc ctgatcgaga cctggcaggc aaacgccgcc       300
     ggacgctaca tacacaagca agatcagcat gcggcaccac tggacccgaa ctttacgggc       360
     accggccgga tgctcaccga tgagcacggc gagtacgaac tgatttccat ccggcccggc       420
     gcgtacccat ggcgcaatca ccacaacgcc tggcggcccg cgcacattca cttcagcgta       480
     ttcgggacca atttcaccca gcgtctggtc tcccagatgt acttccccgg cgatcccctc       540
     ctcgcgtacg acccgatcta ccagggcatt ccggatgaaa agggccggca acggctgatc       600
     agccgctttg atctgaacat cacgcggcct gagtgggcgc tcgggtaccg cttcgacatc       660
     gtgctgggcg gcgaggccca gacgccattc gaggagcctg atcatgagca ctga             714
//

If you have problems or comments...

PBIL Back to PBIL home page