(data stored in ACNUC7421 zone)

EMBL: CP001115.PE101

CP001115.PE101       Location/Qualifiers
FT   CDS_pept        141109..141477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00850"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47490"
FT                   /db_xref="InterPro:IPR021417"
FT                   /db_xref="UniProtKB/TrEMBL:C1D251"
FT                   /protein_id="ACO47490.2"
FT                   /translation="MKSLLLMGLMVTGLAAAQTQGSATIRENGRSYTINCSGNNDVISV
FT                   RGNHNAISLTGICENLVVYGNGNSISGGTLLKVWLRGNDNAVSAPQRTSTPVISNTGKN
FT                   NRYSIGAVTSVSVKKVEK"
     atgaagtcac tccttcttat gggcctgatg gtcactggtc tcgccgccgc acaaacgcag        60
     ggcagtgcca ccattcgtga gaacggacgc agctacacca tcaactgctc cggcaacaac       120
     gatgtcatct ccgtacgcgg aaaccacaac gccatctcgc tgacaggaat ctgcgagaac       180
     ctcgtggtat acggcaacgg gaacagcatt tcggggggca cgctgctgaa agtctggctg       240
     agaggcaacg acaacgccgt ctccgcccca cagcgaacct caacgcccgt catcagcaat       300
     actgggaaaa acaaccgcta ctcgattgga gccgtgacgt ctgtgtccgt caaaaaggtc       360
     gagaagtaa                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page