(data stored in ACNUC7421 zone)

EMBL: CP001115.PE104

CP001115.PE104       Location/Qualifiers
FT   CDS_pept        complement(144011..145381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00880"
FT                   /product="putative histidine kinase, classic"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47494"
FT                   /db_xref="GOA:C1D255"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1D255"
FT                   /protein_id="ACO47494.1"
FT                   /translation="MKRPYWRTLAWRLTLAFVLVSAAALGTVGFISSVYTRSEFSALLG
FT                   AQAQESLTAQVQAYVQANGTVSGFRPSEPHPRNGDRAGPPPRTPGVSRSSWLVLDEQRR
FT                   AVFSTPNVPRGTRVPRPQGTPVTVGNRVVAYLIPSGMRPRPDRRGEDFLSRTAQAIGWS
FT                   MLGATVLAVVMGLLVSRTLLRPLSELRRGIRALQRGDAPIAHQSTRTDEFGEVLHAFGE
FT                   MHQDVVRSQQARRQLTADIAHDLNTPLAVISGTLEAILDGTFKPTSERLKRLHQETQHV
FT                   SQLVNDLRFLSLADAGELHMNHKLAEVEPFIRGAVATFEEMARQGDVTLETHLKVAGVR
FT                   ASVDVVRITQVLQNLLSNALAHTSAGGRVVVTAEVAGQSLTVSVKDTGDGIQPEHLPHV
FT                   FNRLYRADQARSGGGSGLGLSICKTIVEAHGGDIRITSAVGSGTTVTFTLPLPPALS"
     atgaagcgtc cctactggcg aaccctggcc tggcggctga cactggcgtt tgtgctggtc        60
     agcgcggccg cgctgggcac cgtcggtttc atttcctcgg tctacacgcg ctcggagttc       120
     agtgccctgc tgggcgcaca ggcgcaggaa agcctgacgg cgcaggttca ggcctacgtg       180
     caggccaacg gaacagtgag cggcttccgg ccatccgagc cgcacccaag aaatggcgac       240
     cgagccggcc ctcccccacg cacccccggt gtttcccgca gttcctggct ggtgctggac       300
     gagcagcgac gcgccgtctt ttcgacacca aacgttcctc ggggcacccg ggtaccccgg       360
     ccgcaaggca ccccggtcac ggttggaaac agggtcgtgg cctacctgat tccttcgggc       420
     atgcggcccc gtccggatag gcgcggggag gactttctgt cgcggactgc ccaggccatc       480
     ggctggtcta tgctcggggc aaccgtgctg gccgtcgtga tgggcctgct ggtgtcgaga       540
     accctgctca ggcccctgag tgaactgcgc cggggcattc gcgccttgca gcgtggcgac       600
     gcgcccatag cacatcagag cacccgcaca gacgagtttg gcgaggtgct gcatgcattc       660
     ggagaaatgc accaggacgt ggtccgcagc cagcaggccc ggcggcagct cacagccgat       720
     attgcccacg acctcaatac gcctctggcc gtgatttccg gaacattgga agctattctc       780
     gatggcacct tcaaacccac ttctgaacgt ctcaaacgcc tgcaccagga aacccagcac       840
     gtctcgcaac tggtcaacga cctgcggttt ctgtcgctgg cagacgcagg ggagctccac       900
     atgaaccaca agctggcgga ggtcgagccg ttcatccggg gtgccgtcgc gacctttgag       960
     gagatggccc ggcaggggga cgtaacactc gaaacgcatc tgaaggttgc gggggtcagg      1020
     gcttccgttg atgtcgtccg catcacgcag gtgcttcaga acctcctgag taatgctctg      1080
     gcacatacgt cagccggtgg gcgggtggtg gtcaccgcag aggtggctgg ccagagcctg      1140
     accgtgagtg tgaaggacac gggcgacggc atccaaccag agcatctgcc gcatgtgttt      1200
     aaccgactgt accgggcaga tcaggcccgc tccggcggcg gaagtggtct gggcctcagt      1260
     atctgtaaga cgatcgtcga agcacacggg ggtgatatca ggatcaccag tgcggttggc      1320
     agcggcacga ccgtgacgtt caccctgccg ctgccgcctg ccctgtcctg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page