(data stored in ACNUC7421 zone)

EMBL: CP001115.PE106

CP001115.PE106       Location/Qualifiers
FT   CDS_pept        complement(146240..146845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00891"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00891"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47496"
FT                   /db_xref="UniProtKB/TrEMBL:C1D257"
FT                   /protein_id="ACO47496.1"
FT                   /translation="MRHTILTPLLALTVLAGTASATSSTSAQRQVAAQAHQRPAEHQAA
FT                   HQNQTRAGDNRGTERPAQTGMHRPDARQGRVTGQHQRGAQAHNPRGMHIQPARPSDQRG
FT                   TSNSPQAQQGGTLNQLGGALRGATRVTFYNGDPLKGAQPTQTIQLTGSPESQATALNRA
FT                   AQQASFAVIERPGGRVVVDLKATSTQPGQPAPRTPRRR"
     atgcgccata cgatcctgac ccccctgctt gccctcaccg tcctcgccgg aaccgcgtcc        60
     gccaccagtt caacgtccgc ccagcgtcag gttgccgctc aggcacacca gcgaccggca       120
     gagcatcagg cagcccacca gaaccagacc agggcgggtg acaaccgcgg gactgagcgt       180
     ccggcacaga ccggcatgca ccggccggat gcccggcagg gccgagtcac cgggcaacac       240
     cagcggggag cccaggcgca caacccgcgg ggcatgcaca ttcagcctgc ccggccatca       300
     gatcagcgag gcacctccaa ctctccccag gctcagcagg gaggaaccct gaaccagctt       360
     ggcggcgccc ttcgcggggc aacgcgcgtc acgttctaca acggtgatcc gctgaagggc       420
     gcccagccga cgcagaccat tcagctgacc ggctctccgg agtcccaggc cacggccctg       480
     aaccgtgcgg ctcagcaggc aagcttcgcg gtgattgaac ggccgggtgg gcgggtcgtc       540
     gtggacctga aggccacttc cacccagccg ggacagcctg ctccccgcac ccctcggcgc       600
     cgctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page