(data stored in ACNUC7421 zone)

EMBL: CP001115.PE107

CP001115.PE107       Location/Qualifiers
FT   CDS_pept        complement(147008..147424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00910"
FT                   /product="Conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47497"
FT                   /db_xref="UniProtKB/TrEMBL:C1D258"
FT                   /protein_id="ACO47497.1"
FT                   /translation="MRNLTTLKAFTVSALLTASTLFVNASAAPVFFHNDAGASGIVDIY
FT                   VDGTLVFDDIAPDNAMMFPQELASGRHEVIVTPYNRAPGVQDVLRTTIEIEHASSYHLT
FT                   LGNTSAVYLDELTGELTQAPWTGEPWLSLDTGLN"
     atgcgtaacc tcaccacact gaaagctttc actgtctccg ctctgctcac cgccagcacc        60
     ctgttcgtca atgcgtccgc ggctccagtg ttcttccaca atgatgctgg tgccagtggc       120
     atcgtggaca tttatgtaga cggcaccctg gtgttcgacg atattgctcc ggacaacgcc       180
     atgatgttcc cgcaagagct ggccagcggc cggcacgaag tgatcgttac gccgtacaac       240
     cgggctcctg gagtacagga cgtgctgcgc accaccattg aaatcgagca cgcaagctcg       300
     taccacctga cgctggggaa cacctccgct gtttacctgg acgagcttac cggtgagctc       360
     acccaggcgc cctggaccgg agagccctgg ctcagcctgg ataccggcct caactga          417
//

If you have problems or comments...

PBIL Back to PBIL home page