(data stored in ACNUC7421 zone)

EMBL: CP001115.PE108

CP001115.PE108       Location/Qualifiers
FT   CDS_pept        148405..148911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Deide_1p00914"
FT                   /product="Hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Deide_1p00914"
FT                   /db_xref="EnsemblGenomes-Tr:ACO47500"
FT                   /db_xref="UniProtKB/TrEMBL:C1D261"
FT                   /protein_id="ACO47500.1"
FT                   /translation="MNSLYLSATMVLGSLVLSGCEAAERKHYEQRQLTLDRNNAQFYLS
FT                   QCVQAIERRRAQPGVAQGRLPRKLDGTNCENPLLGDYALDPAQGRIIEKSVIRLDSSRL
FT                   SSYTIEVHGRDGEVYTYVDRGRAAAEAEQAGTFADSSAGGTVSPPPDVTEGEPNRPEVE
FT                   ENQSQ"
     atgaacagtt tgtatctgtc tgcaacgatg gttttgggaa gtctggtttt gtctggatgt        60
     gaggctgcgg agcgaaaaca ctacgaacag agacagctga ctctcgaccg caataacgca       120
     caattttatc tttctcaatg tgttcaggct atcgaacgcc gccgcgcaca gcctggggtg       180
     gctcagggcc ggctgccccg aaaacttgac ggcacaaatt gcgagaaccc gttattgggc       240
     gactatgcgc tggatcccgc gcaaggccgc atcattgaaa aaagtgtcat acggcttgat       300
     tcttccaggc tcagcagcta cacgattgaa gtgcacggcc gggacggtga agtttatacc       360
     tacgtagatc gaggtagagc tgcggctgaa gcggagcagg cgggtacatt cgctgattca       420
     tcggctggtg gaacggtttc ccccccgcca gacgttacgg aaggcgaacc caaccggcca       480
     gaggttgaag aaaatcagag ccaataa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page